ESTScan Details for Unigene SGN-U338797

Score 
-231
Direction 
Reverse
Predicted Peptide Sequence 
PFSPKXEKKGGPGFSGKAGRVSETGRGPRXEVFPGGKPPGNSLKIPAGFPPPLDLGGGFFLMLVRGGGAYGKTPAPGPFYGFRPFGGPLA
HKFFPALSPDFVDNRITPLSEGIPLAAAERPSAAFIEEEAEEPPIRKPPLPAVGRFINAAGXDRFPDWKAGSERNAINXELAPSLGPPGL
HFKLPARMLCGIVTDNNFPQETAMPMITPSWKLTLPKGXQKLELPRGGGRFRISGSPGLQEFGPRGKHVVFGQVVEGMDVIKKAEAVGFS
FGRCPNPVVIADCGQL
Predicted Coding Sequence 
XCCCCGTTTTCCCCTAAGGXGGAGAAAAAGGGGGGCCCCGGTTTTTCCGGTAAAGCGGGCAGGGTTTCGGAAACAGGAAGAGGGCCCCGG
GXGGAGGTTTTTCCAGGGGGAAAACCCCCCGGGAATTCTTTAAAAATCCCGGCGGGTTTTCCGCCCCCTTTGGACTTGGGGGGTGGATTT
TTTTTGATGCTTGTCAGGGGGGGGGGAGCCTATGGAAAAACCCCAGCACCGGGGCCTTTTTACGGTTTCCGGCCTTTTGGTGGGCCTTTG
GCTCACAAGTTTTTTCCGGCGTTATCCCCTGATTTTGTGGATAACCGTATTACCCCTTTGAGTGAGGGGATACCGCTCGCCGCAGCCGAA
CGACCGAGCGCAGCATTCATTGAGGAGGAAGCGGAAGAGCCCCCAATACGCAAACCGCCTCTCCCCGCCGTTGGCCGATTCATTAATGCA
GCTGGCCXCGACAGGTTTCCCGACTGGAAAGCGGGCAGTGAGCGCAACGCAATTAATGXTGAGTTAGCTCCCTCATTAGGCCCCCCAGGT
TTACACTTTAAGCTTCCGGCTCGTATGTTGTGTGGAATTGTGACGGATAACAATTTCCCCCAGGAAACAGCTATGCCCATGATTACGCCA
AGCTGGAAATTAACCCTCCCTAAAGGGAAXCAAAAGCTGGAGCTCCCCCGCGGTGGCGGCCGCTTTAGAATTAGTGGATCCCCCGGGCTG
CAGGAATTCGGCCCGAGGGGAAAGCACGTCGTTTTTGGACAAGTTGTTGAAGGGATGGATGTGATTAAGAAGGCAGAGGCTGTTGGATTT
AGCTTTGGAAGGTGCCCCAACCCTGTGGTTATTGCTGACTGCGGTCAACTTTAG
Edits in Original Sequence 
(5')XCCCCGTTTTCCCCTAAGGXGGAGAAAAAGGGGGGCCCCGGTTTTTCCGGTAAAGCGGGCAGGGTTTCGGAAACAGGAAGAGGGCC
CCGGGXGGAGGTTTTTCCAGGGGGAAAACCCCCCGGGAATTCTTTAAAAATCCCGGtCGGGTTTTCCGCCCCCTTTGGACTTGGGGGGTG
GATTTTTTTTGATGCTTGTCAGGGGGGGGGGAGCCTATGGAAAAAcCCCCAGCACCGGGcGCCTTTTTACGGTTTCCGGCCTTTTGGTGG
GCCTTTGGCTCACAAGTTTTTTCCGGCGTTATCCCCTGATTTTGTGGATAACCGTATTAcCCCCTTTGAGTGAGGGGATACCGCTCGCCG
CAGCCGAACGACCGAGCGCAGCgATTCATTGAGcGAGGAAGCGGAAGAGCCCCCAATACGCAAACCGCCTCTCCCCGCgCGTTGGCCGAT
TCATTAATGCAGCTGGCCXCGACAGGTTTCCCGACTGGAAAGCGGGCAGTGAGCGCAACGCAATTAATGXTGAGTTAGCTCCCTCATTAG
GCCCCCCAGGcTTTACACTTTAAGCTTCCGGCTCGTATGTTGTGTGGAATTGTGAgCGGATAACAATTTCCCCCAGGAAACAGCTATGCC
CATGATTACGCCAAGCTGGAAATTAACCCTCCCTAAAGGGAAXCAAAAGCTGGAGCTCCCCCGCGGTGGCGGCCGCTTTAGAATTAGTGG
ATCCCCCGGGCTGCAGGAATTCGGCCCGAGGGGAAAGCACGTCGTTTTTGGACAAGTTGTTGAAGGGATGGATGTGATTAAGAAGGCAGA
GGCTGTTGGATTTAGCTTTGGAAGGTGCCCCAACCCTGTGGTTATTGCTGACTGCGGTCAACTTTAG(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan