ESTScan Details for Unigene SGN-U338848

Score 
57
Direction 
Reverse
Predicted Peptide Sequence 
MDRXAKTYKDKSIQPSIGKQREISLRDPDKPDYRELQFTLHKKLTETFPRAEFLQPGGSTSSRAAATAVEAPAFX
Predicted Coding Sequence 
ATGGATCGCXATGCCAAGACTTACAAGGACAAGTCTATACAACCTTCGATAGGCAAACAAAGAGAAATTTCACTAAGGGACCCTGACAAA
CCAGATTACAGGGAACTACAATTCACACTTCACAAGAAATTAACAGAAACATTTCCTCGTGCCGAATTCCTGCAGCCCGGGGGATCCACT
AGTTCTAGAGCGGCCGCCACCGCGGTGGAGGCTCCAGCTTTTGXX
Edits in Original Sequence 
TTCCCATCTATGTCAATGGATGAAGTACAACCACAAAAACTACCATGAAAAAGATGTATAATCATACATGAGAAAGCAAATAGTACTCCA
TCCGTTTCAATTTGTTTTGTACTACTTTCCTATTATAGTCCAGTCCTGTTGAAAAAGAACGAGACTTTTTCCTTTTTTTAGCAACTCTTT
AGCTCAAACTTTCTACATAACATGCTTAATACCACAAGGATAGTTTAGATACATTTGACAACTTTAATTTTAGAACACAAAATATATGAT
TCTTTTTTCTTCCAGACCTCACTTGTGGGATTTTATTAGGTATGTCATTGTTATATTCTTTTTCTTTGTATTTCATCCAAAAATATGCAC
ATTTTTTTTTTTATGATTTATCCCCAACCTCTATCACACTATAACAGACCTCATTTCAAAGAGCAAAGAGGAAAAACATAAATTTAGTGC
ACCACGCCACTAGGAATGACATGGGAATTGAAAATGATATCACCCAGACAAGTTTAAAAAAGTCTAGAAGATAACACCATGGATCGCATG
CCAAGACTTACAAGGACAAGTCTATACAACCTTCGATAGGCAAACAAATGAGAAATTTCACTAAGGGACCCTGACAAACCAGATTACTAG
GGAACTACAATTCACACTTCACAAGAAATTAACAGAAACATTTC
(5')ATGGATCGCXATGCCAAGACTTACAAGGACAAGTCTATACAA
CCTTCGATAGGCAAACAAAtGAGAAATTTCACTAAGGGACCCTGACAAACCAGATTACtAGGGAACTACAATTCACACTTCACAAGAAAT
TAACAGAAACATTTCCTCGTGCCGAATTCCTGCAGCCCGGGGGATCCACTAGTTCTAGAGCGGCCGCCACCGCGGTGGAGGCTCCAGCTT
TTGXX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan