ESTScan Details for Unigene SGN-U338852

Score 
424
Direction 
Forward
Predicted Peptide Sequence 
RGGGRDDRLLWANGGQSAEXGGESKETKNPVIWGQIXKVHLFEEVAKHNKTKDCWLIISGKVYDVTPFMEDHPGGDEVLLSATGKDATND
FEDVGHSDSAREMMDKYYIGDIDQSTVPLKRAYIPPEQAPYNPDKTSKFVIKILQILVPLLILGLAFAXATLHQGEVNPLQSNSNIQNAF
YLNYIGAIVAEP
Predicted Coding Sequence 
AGGGGGGGGGGCCGNGATGATCGACTCCTATGGGCGAATGGCGGCCAATCGGCCGAAXTTGGTGGAGAATCCAAAGAGACTAAAAATCCT
GTTATATGGGGTCAGATCATXAAAGTTCATCTATTTGAGGAGGTTGCAAAGCACAACAAGACCAAAGATTGTTGGCTTATTATCAGTGGA
AAGGTGTATGATGTGACTCCATTTATGGAAGATCATCCAGGTGGTGATGAAGTTTTGCTTTCAGCAACAGGGAAAGATGCAACAAATGAC
TTTGAAGACGTCGGCCACAGTGATTCTGCTAGGGAGATGATGGATAAATATTACATTGGAGATATTGATCAGTCAACAGTTCCTCTAAAA
CGTGCTTACATTCCTCCAGAACAAGCCCCATACAATCCAGACAAGACTTCAAAATTTGTTATCAAAATTTTGCAAATCCTTGTGCCCCTC
TTGATTTTGGGCTTAGCCTTTGCTGXTGCGACACTACACCAAGGAGAAGTAAATCCATTACAATCTAATTCGAATATCCAGAATGCTTTC
TATTTGAATTACATAGGAGCTATAGTAGCTGAACCATGA
Edits in Original Sequence 
(5')AGGGGGGGGGGCCGNGATGATCGACTCCTATGGGCGAATGGCGGCCAATCGGCCGAAXTTGGTGGAGAATCCAAAGAGACTAAAAA
TCCTGTTATATGGGGTCAGATCATXAAAGTTCATCTATTTGAGGAGGTTGCAAAGCACAACAAGACCAAAGATTGTTGGCTTATTATCAG
TGGAAAGGTGTATGATGTGACTCCATTTATGGAAGATCATCCAGGTGGTGATGAAGTTTTGCTTTCAGCAACAGGGAAAGATGCAACAAA
TGACTTTGAAGACGTCGGCCACAGTGATTCTGCTAGGGAGATGATGGATAAATATTACATTGGAGATATTGATCAGTCAACAGTTCCTCT
AAAACGTGCTTACATTCCTCCAGAACAAGCCCCATACAATCCAGACAAGACTTCAAAATTTGTTATCAAAATTTTGCAAATCCTTGTGCC
CCTCTTGATTTTGGGCTTAGCCTTTGCTGXTGCGACACTACACCAAGGAGAAGTAAATCCATTACAATCTAATTCGAATATCCAGAATGC
TTTCTATTTGAATTACATAGGAGCTATAGTAGCTGAACCATGA(3')AACNTT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan