Notice: Please give us important feedback on the future of SGN using this survey: https://www.surveymonkey.com/r/VJTRHVC

ESTScan Details for Unigene SGN-U338898

Score 
147
Direction 
Forward
Predicted Peptide Sequence 
GVSITMGELAANRPNSHCPAPADDIKILRCGPPPMNKAMAAHLEALGYSPEMQFQF
Predicted Coding Sequence 
XXCGGAGTATCGATCACTATGGGCGAATTGGCGGCCAATCGGCCGAATTCTCATTGCCCTGCCCCGGCAGATGATATTAAGATACTGAGG
TGTGGTCCACCACCGATGAACAAGGCAATGGCTGCTCATCTTGAAGCCCTCGGATACTCACCGGAGATGCAATTCCAATTCTAA
Edits in Original Sequence 
(5')XXCGGAGTATCGATCACTATGGGCGAATTGGCGGCCAATCGGCCGAATTCTCATTGCCCTGCCCCGGCAGATGATATTAAGATACT
GAGGTGTGGTCCACCACCGATGAACAAGGCAATGGCTGCTCATCTTGAAGCCCTCGGATACTCACCGGAGATGCAATTCCAATTCTAA(3')
AATTATAGTCTGGAGAAAGACATATTGACATTGTCATTTTTCAGTGAAGAGACTCATAAACCTGCTTTTCATTTTGAATAACATCTCA
TTCTTGAGT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan