ESTScan Details for Unigene SGN-U338959

Score 
613
Direction 
Forward
Predicted Peptide Sequence 
MSLQTGTNRKIGKGHLHNKKLGTTKTAXLKLKAVFSCSICKSFYPNVTQASMVAPFTGLKSSATFPVTKKQNLDITSIASNGGRVSCMQV
WPPINMKKYETLSYLPDLSDEQLLSEIEYLLKNGWVPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAXKG
IPTSMGQNHWIPQCASSAGDQFHWLPAKKVTKFHIRNQNCFKDHLGFXKAT
Predicted Coding Sequence 
ATGAGTTTACAAACTGGAACAAATAGGAAGATTGGAAAAGGACATTTGCACAACAAAAAATTAGGAACAACGAAAACCGCTXTTCTAAAA
CTGAAGGCCGTGTTCTCGTGCAGCATCTGCAAGAGCTTCTATCCCAATGTTACACAAGCTAGCATGGTTGCACCTTTCACTGGTCTCAAA
TCTTCAGCCACTTTCCCTGTTACAAAGAAGCAAAACCTTGACATCACTTCCATTGCTAGCAATGGTGGAAGAGTTAGCTGCATGCAGGTG
TGGCCACCAATTAACATGAAGAAGTACGAGACACTCTCATACCTTCCTGATTTGTCTGACGAGCAATTGCTTAGTGAAATTGAGTACCTT
TTGAAAAATGGATGGGTTCCTTGCTTGGAATTTGAGACTGAGCACGGATTTGTCTACCGTGAGAACAACAAGTCACCAGGATACTATGAT
GGAAGGTACTGGACCATGTGGAAGTTGCCTATGTTTGGGTGCACTGATGCAACCCAAGTGTTGGCTGAGGTTCAAGAAGCTXTAAAAGGC
ATACCCACAAGCATGGGTCAGAATCATTGGATTCCACAATGTGCGTCAAGTGCAGGGGATCAATTTCATTGGCTACCAGCCAAGAAAGTT
ACTAAATTTCATATTAGGAACCAAAATTGCTTTAAGGACCACCTTGGTTTTAAXAAGGCTACTTAA
Edits in Original Sequence 
ACATTTAAAACTCCAGTTCATCTCTCTTGTTAGTCATGAGTTTTACAAACTGGAACAAATAGGAAGATTGGAAAAGGACATTTGCACAAC
AAAAAATTAGGAACAACGAAAACCGCTTTCTAAAACTGAAGGCCGTGTTCTC
(5')ATGAGTTtTACAAACTGGAACAAATAGGAAGATT
GGAAAAGGACATTTGCACAACAAAAAATTAGGAACAACGAAAACCGCTXTTCTAAAACTGAAGGCCGTGTTCTCGTGCAGCATCTGCAAG
AGCTTCTATCCCAATGTTACACAAGCTAGCATGGTTGCACCTTTCACTGGTCTCAAATCTTCAGCCACTTTCCCTGTTACAAAGAAGCAA
AACCTTGACATCACTTCCATTGCTAGCAATGGTGGAAGAGTTAGCTGCATGCAGGTGTGGCCACCAATTAACATGAAGAAGTACGAGACA
CTCTCATACCTTCCTGATTTGTCTGACGAGCAATTGCTTAGTGAAATTGAGTACCTTTTGAAAAATGGATGGGTTCCTTGCTTGGAATTT
GAGACTGAGCACGGATTTGTCTACCGTGAGAACAACAAGTCACCAGGATACTATGATGGAAGGTACTGGACCATGTGGAAGTTGCCTATG
TTTGGGTGCACTGATGCAACCCAAGTGTTGGCTGAGGTTCAAGAAGCTXTAAAAGGCATACCCACAAGCATGGGTCAGAATCATTGGATT
CCACAATGTGCGTCAAGTGCAGGGGATCAATTTCATTGGCTACCAGCCAAGAAAGTTACTAAATTTCATATTAGGAACCAAAATTGCTTT
AAGGACCACCTTGGTTTTAAXAAGGCTACTTAA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan