ESTScan Details for Unigene SGN-U338963

Score 
-27
Direction 
Forward
Predicted Peptide Sequence 
SIDALLXIPXEDALELPDPPNLDITSIASNGGRVSCMQVWPPINMKKYETLSYLPDYPTSNCSAEIEYLLKNGWVPCLEFETEHGFVYRE
NHKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAWVRIIGFYNVLKCSASVSSLTSPKDTKCVYVNSEKLFAFSRKLVSLY
SMYEVGXPVEFIMRTNNNSNNLCFFKKKKNKLEGGPXYPIRPIVSRITIHLPSVYNVVTGKTLATPLNRLEDIPLWQLRNSEWPARSSFQ
QCQPEWEWQW
Predicted Coding Sequence 
XACTCTATCGATGCTCTACTGCANATCCCCGNGGAGGATGCTCTAGAACTACCGGATCCCCCAAACCTTGACATTACCTCCATTGCTAGC
AACGGTGGAAGAGTCAGTTGCATGCAGGTGTGGCCACCAATTAACATGAAGAAGTACGAGACTCTGTCGTACCTTCCTGATTATCCGACG
AGCAATTGCTCAGCXGAAATTGAGTACCTATTGAAAAATGGATGGGTTCCTTGCTTGGAATTCGAGACTGAGCACGGATTTGTGTACCGT
GAGAACCATAAGTCACCAGGATACTACGATGGCAGATACTGGACCATGTGGAAGTTGCCCATGTTCGGGTGCACTGATGCAACCCAGGTC
TTGGCTGAGGTGCAGGAGGCAAAGAAGGCTTACCCACAGGCATGGGTCCGTATCATCGGATTCTACAATGTTCTCAAGTGCAGTGCATCA
GTTTCATCGCTTACAAGCCCGAAGGATACTAAATGTGTATATGTCAACAGTGAGAAACTGTTCGCATTTTCACGGAAGCTTGTCTCTTTG
TATTCAATGTATGAAGTTGGAXTTCCAGTTGAATTTATTATGAGAACTAATAATAATAGTAATAATCTTTGTTTCTTTAAAAAAAAAAAA
AATAAACTCGAGGGGGGGCCCGXGTACCCAATTCGCCCTATAGTGAGTCGTATTACAATTCACTTGCCGTCGGTTTACAACGTCGTGACT
GGGAAAACCCTGGCTACCCCACTTAATCGCCTTGAGGACATACCCCTTTGGCAGCTGCGTAATAGCGAATGGCCCGCACGATCGTCCTTC
CAACAATGCCAGCCTGAATGGGAATGGCAATGGTAG
Edits in Original Sequence 
(5')XACTCTATCGATGCTCTACTGCANATCCCCGNGGAGGATGCTCTAGAACTACCGGATCCCCCgAAACCTTGACATTACCTCCATTG
CTAGCAACGGTGGAAGAGTCAGTTGCATGCAGGTGTGGCCACCAATTAACATGAAGAAGTACGAGACTCTGTCGTACCTTCCTGATTAgT
CCGACGAGCAATTGCTCAGCXGAAATTGAGTACCTATTGAAAAATGGATGGGTTCCTTGCTTGGAATTCGAGACTGAGCACGGATTTGTG
TACCGTGAGAACCATAAGTCACCAGGATACTACGATGGCAGATACTGGACCATGTGGAAGTTGCCCATGTTCGGGTGCACTGATGCAACC
CAGGTCTTGGCTGAGGTGCAGGAGGCAAAGAAGGCTTACCCACAGGCATGGGTCCGTATCATCGGATTCTACAATGTTCgTCAAGTGCAG
TGCATCAGTTTCATCGCTTACAAGCCCGAAGGATACTAAATGTGTATATGTCAACAGTGAGAAACTGTTCGCATTTTCACGGAAGCTTGT
CTCTTTGTATTCAATGTATGAAGTTGGAXTTCCAGTTGAATTTATTATGAGAACTAATAATAATAGTAATAATCaTTTGTTTCTTTAAAA
AAAAAAAAAATAAACTCGAGGGGGGGCCCGXGTACCCAATTCGCCCTATAGTGAGTCGTATTACAATTCACTTGCCGTCGGTTTACAACG
TCGTGACTGGGAAAACCCTGGCgTACCCCACTTAATCGCCTTGAGGACATACCCCTTTGGCAGCTGCGTAATAGCGAATaGGCCCGCACG
ATCGTCCTTCCAACAATGCCAGCCTGAATGGGAATGGCAATGGTAG(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan