ESTScan Details for Unigene SGN-U338968

Score 
274
Direction 
Reverse
Predicted Peptide Sequence 
IGDPPGRRNLAGREEAKWFPLSFPQQRLVPXTNVTQGSMVAPFPGFKFSAPFPVTKKQNLDITSIVSKGGRVSCMQVXAPNYHEEEGPLS
SLPDFFGEQLLREMESLLKKGGVPCLEFETEPGFFFRGNNKSPGFFDGRFWPMGKFPMFGGPDATQVLAEVQEGKKASPQPGVRIIGFDK
GGKGRVSVSLPPNQKGIKFHIRNXNFF
Predicted Coding Sequence 
ATAGGGGATCCCCCGGGCCGCAGGAATTTGGCCGGGAGAGAAGAAGCAAAATGGTTTCCTCTTTCATTTCCTCAGCAGCGGTTGGTCCCC
GXCACCAATGTTACCCAAGGTAGCATGGTTGCCCCTTTCCCTGGTTTCAAATTTTCAGCCCCTTTCCCTGTTACAAAAAAGCAAAACCTT
GACATCACTTCCATTGTTAGCAAAGGGGGAAGAGTTAGCTGCATGCAGGTGGXGGCCCCCAATTACCATGAAGAAGAGGGGCCCCTCTCA
TCCCTTCCTGATTTTTTTGGGGAGCAATTGCTTAGGGAAATGGAGTCCCTTTTGAAAAAAGGAGGGGTTCCTTGCTTGGAATTTGAGACT
GAGCCCGGATTTTTTTTCCGGGGGAACAACAAGTCCCCCGGATTTTTTGATGGAAGGTTCTGGCCCATGGGGAAGTTCCCTATGTTTGGG
GGCCCTGATGCAACCCAAGTTTTGGCTGAGGTTCAAGAGGGTAAAAAGGCATCCCCCCAACCAGGGGTCAGAATCATTGGATTTGACAAA
GGGGGCAAGGGCAGGGTATCAGTTTCATTGCCTCCAAACCAGAAGGGTATTAAGTTTCATATTAGGAACAAXAATTTTTTTTAG
Edits in Original Sequence 
TCATTTCCTCAGCAGCGGTTGGTCCCCGCACCAATGTTACCCAAGGTAGCATGGTTGCCCCTTTCCCTGGTTTCAAATTTTCAGCCCCTT
TCCCTGTTACAAAAAAGCAAAACCTTGACATCACTTCCATTGTTAGCAAAGGGGGAAGAGTTAGCTGCATGCAGGTGGGGCCCCCAATTA
CCATGAAGAAGTAGGGGCCCCTCTCATCCCTTCCTGATTTTTTTGGGGAGCAATTGCTTAGGGAAATGGAGTCCC
(5')ATAGGGGATCC
CCCGGGCCGCAGGAATTTGGCCGGGAGAGAAGAAGCAAAATGGTTTCCTCTTTCATTTCCTCAGCAGCGGTTGGTCCCCGXCACCAATGT
TACCCAAGGTAGCATGGTTGCCCCTTTCCCTGGTTTCAAATTTTCAGCCCCTTTCCCTGTTACAAAAAAGCAAAACCTTGACATCACTTC
CATTGTTAGCAAAGGGGGAAGAGTTAGCTGCATGCAGGTGGXGGCCCCCAATTACCATGAAGAAGtAGGGGCCCCTCTCATCCCTTCCTG
ATTTTTTTGGGGAGCAATTGCTTAGGGAAATGGAGTCCCTTTTGAAAAAAGGAGGGGTTCCTTGCTTGGAATTTGAGACTGAGCCCGGAT
TTTTTTTCCGGGGGAACAACAAGTCCCCCGGATTTTTTGATGGAAGGTTCTGGCCCATGGGGAAGTTCCCTATGTTTGGGGGCCCTGATG
CAACCCAAGTTTTGGCTGAGGTTCAAGAGGGTAAAAAGGCATCCCCCCAACCAGGGGTCAGAATCATTGGATTTGACAAAGGGGGtCAAG
GGCAGGGTATCAGTTTCATTGCCTCCAAACCAGAAGGGTATTAAGTTTCATATTAGGAACAAXAATTTTTTTTAG(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan