ESTScan Details for Unigene SGN-U338978

Score 
198
Direction 
Reverse
Predicted Peptide Sequence 
MCTTNIPNTVHQEWAKYMVPLHDQVPALPVQKQPCIPPFYNGGKSVACRWATNYIKSRDSVDPSYLADEQLLSEIEYLLKNGWVPCLEFE
TEHGXVYRENHKSPGSYHGRYWSMWNFSMFGCPDATPGPVLGAGGKKAYPQAWDRIIGFDNVRQVQCISFIAYKPEGY
Predicted Coding Sequence 
ATGTGCACXACAAATATTCCTAACACTGTCCACCAGGAATGGGCCAAGTACATGGTGCCCCTCCATGACCAAGTCCCCGCTCTTCCTGTT
CAGAAACAACCTTGCATTCCTCCTTTCTACAACGGTGGAAAGTCAGTTGCATGCAGGTGGGCCACCAATTACATAAAGAGTAGAGACTCT
GTCGACCCTTCTTATTTGGCCGACGAGCAATTGCTCAGCGAAATTGAGTACCTATTGAAAAATGGATGGGTTCCTTGCTTGGAATTCGAG
ACTGAGCACGGTNNNGTGTACCGTGAGAACCATAAGTCACCAGGATCTTACCATGGCAGATACTGGTCCATGTGGAATTTCTCCATGTTC
GGGTGCCCTGATGCAACXCCAGGCCCTGTCTTAGGTGCGGGAGGCAAGAAGGCTTACCCACAGGCTTGGGACCGTATCATCGGATTCGAC
AATGTTCGTCAAGTGCAGTGCATCAGTTTCATCGCTTACAAGCCCGAAGGATACTAA
Edits in Original Sequence 
CGTGAGAACCATAAGTCACCAGGATCTTACCATGGCAGATACTGGTC(5')ATGTGCACXACAAATATTCCTAACACTGTCCACCAGGAA
TGGGCCAAGTACATGGTGCCCCTCCATGACCAAGTCCCCGCTCTTCCTGTTCAGAAACaAACCTTGCATTCCTCCTTTCTACAACGGTGG
AAAGTCAGTTGCATGCAGGTGGGCCACCAATTACATAAAGAGTAcGAGACTCTGTCGACCCTTCTTATTTGGCCGACGAGCAATTGCTCA
GCGAAATTGAGTACCTATTGAAAAATGGATGGGTTCCTTGCTTGGAATTCGAGACTGAGCACGGTNNNGTGTACCGTGAGAACCATAAGT
CACCAGGATCTTACCATGGCAGATACTGGTCCATGTGGAATTTCTCCATGTTCGGGTGCCCTGATGCAACXCCAGGCCCTGTCTTAGGTG
CGGGAGGCAAGtAAGGCTTACCCACAGGCTTGGGACCGTATCATCGGATTCGACAATGTTCGTCAAGTGCAGTGCATCAGTTTCATCGCT
TACAAGCCCGAAGGATACTAA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan