ESTScan Details for Unigene SGN-U338984

Score 
568
Direction 
Forward
Predicted Peptide Sequence 
MALTFTSSSAIHGSLSSSSSSYEQPKLSQWLKGTRERERERERXETVSRNQNLDITSIASNGGKVSCMQVWPPINMKKYKTLSYLPDLSD
EQLLSEIEYLLKNGWVPCLEFETDHGFVVPVKTISHQKTTMAHTVPCESCPCFGCTDATHVLAEVKEAKKAKPQEWAVSSDSKMFRQGPP
PXFSSLKTPKEN
Predicted Coding Sequence 
ATGGCTTTGACTTTCACTTCTTCATCTGCAATTCATGGCTCTTTGTCTTCTTCATCTTCTTCTTATGAACAACCCAAACTATCCCAATGG
CTGAAAGGTACTAGAGAGAGAGAGAGAGAGAGAGAGAGAGAXGAGACTGTTTCAAGGAATCAAAACCTTGACATTACCTCCATTGCTAGC
AACGGTGGAAAAGTCAGTTGCATGCAGGTGTGGCCACCAATTAACATGAAGAAGTACAAGACTCTGTCGTACCTTCCTGATTTGTCCGAC
GAGCAATTGCTCAGCGAAATTGAGTACCTATTGAAAAATGGATGGGTTCCTTGCTTGGAATTCGAGACTGATCACGGATTTGTTGTACCX
GTGAAAACCATATCTCACCAAAAAACTACAATGGCACATACTGTACCATGTGAAAGTTGCCCATGTTTTGGGTGCACTGATGCAACCCAT
GTCTTGGCTGAGGTGAAGGAGGCAAAAAAAGCTAAACCTCAGGAATGGGCCGTATCTTCTGATTCCAAAATGTTCCGACAAGGGCCTCCG
CCTXCATTTTCATCGCTTAAAACCCCGAAGGAAAATTAA
Edits in Original Sequence 
CTTCTTCCCATCACCATCTTCTTCTATTTTTCACAAGCAATTTCTTTGCTGGAACAAATTGTTCTTTGTCTCTGTGAAATTAATCTCTCT
TTGTTGTAAAAATGGCTTTGACTTTCACTTCTTCATCTGCAATTCATGGCTCTTTGTCTTCTTCATCTTCTTCTTATGAACAACCCAAAC
TATCCCAATG
(5')ATGGCTTTGACTTTCACTTCTTCATCTGCAATTCATGGCTCTTTGTCTTCTTCATCTTCTTCTTATGAACAACCCA
AACTATCCCAATGGCTGAAAGGTACTAGAGAGAGAGAGAGAGAGAGAGAGAGAGAXGAGACTGTTTCAAGGAATCAAAACCTTGACATTA
CCTCCATTGCTAGCAACGGTGGAAAAGTCAGTTGCATGCAGGTGTGGCCACCAATTAACATGAAGAAGTACAAGACTCTGTCGTACCTTC
CTGATTTGTCCGACGAGCAATTGCTCAGCGAAATTGAGTACCTATTGAAAAATGGATGGGTTCCTTGCTTGGAATTCGAGACTGATCACG
GATTTGTTGTACCXGTGAAAACCATATCTCACCAAAAAACTACAATGGCACATACTGTACCATGTGAAAGTTGCCCATGTTTTGGGTGCA
CTGATGCAACCCATGTCTTGGCTGAGGTGAAGGAGGCAAAAAAAGCTAAACCTCAGGAATGGGtCCGTATCTTCTGATTCCAAAATGTTC
CGACAAGGGCCTCCGCCTXCATTTTCATCGCTTAAAACCCCGAAGGAAAATTAA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan