ESTScan Details for Unigene SGN-U339016

Score 
44
Direction 
Reverse
Predicted Peptide Sequence 
MSYLTKINGNFNKNINGYNLPFAIQAAATLGRAIGAGLFAITPAGERGMCCKAIKLGNARVFPVTTL
Predicted Coding Sequence 
ATGAGTTATTTAACAAAAATTAACGGGAATTTTAACAAAAATATAAACGGTTACAATTTGCCATTCGCCATTCAGGCTGCXGCAACGTTG
GGAAGGGCGATTGGTGCGGGCCTCTTTGCTATTACGCCAGCTGGCGAAAGGGGGATGTGCTGCAAGGCGATTAAGTTGGGTAACGCCAGG
GTTTTCCCAGTCACGACGTTGTAA
Edits in Original Sequence 
AATCCACACAAATAGTAATGATTTCCTCAAACTGATATGATATAGGAATTTTCTCATTCAATAAATATTGACATTATT(5')ATGAGTTA
TTTAACAAAAATTAACGGGAATTTTAACAAAAATATAAACGGTTACAATTTGCCATTCGCCATTCAGGCTGCXGCAACGTTGGGAAGGGC
GATTGGTGCGGGCCTCTTTGCTATTACGCCAGCTGGCGAAAGGGGGATGTGCTGCAAGGCGATTAAGTTGGGTAACGCCAGGGTTTTCCC
AGTCACGACGTTGTAA(3')ACATTAAATGGAAACATGAGATAATACTGGCAATCTGTTGTTTGCTACCGTGCATTCATAGCCCCCACCA
CCAAACTTCTCCATCCCATCAAAAAAACAAATTGACTGGCAACATAATAGCAAAACCGGACTAGTTCTCTCCTCC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan