Notice: The SGN server will be upgraded later today. SGN may be intermittently unavailable during the upgrade. We apologize for any inconvenience.

ESTScan Details for Unigene SGN-U339052

Score 
323
Direction 
Forward
Predicted Peptide Sequence 
MAGKIMHAVQYDSYGGGAAALKHVEVPVPTPKKDEVLLKLEAASINPVDWKIQKGVLRPLLPTKFPFIPTXDXGGEGVKXGSNVKSFKAG
ARVVAXAQYPDGGGLAEXAVAMRVXLFQTAEYSSEVQSCLQSTVSALSSSELAHGLTRRHLLRCFVVVLVSLQLEPSTALDGNYLKPXLS
LSNPGL
Predicted Coding Sequence 
ATGGCTGGGAAGATTATGCATGCTGTTCAGTACGACTCTTATGGCGGTGGAGCCGCTGCCTTGAAGCATGTGGAAGTTCCTGTCCCAACT
CCGAAGAAGGATGAGGTCTTGCTAAAACTCGAGGCTGCAAGCATAAATCCTGTTGACTGGAAAATTCAGAAGGGCGTGCTTCGTCCCCTT
CTTCCTACCAAGTTTCCTTTTATTCCTACTCNCGACGXTGGAGGAGAAGGTGTTAAGGNAGGATCTAATGTAAAAAGCTTCAAGGCTGGT
GCAAGGGTTGTGGCTXATGCTCAATACCCTGATGGAGGTGGATTGGCTGAAXTTGCGGTGGCTATGAGAGTTGAXCTGTTCCAGACCGCT
GAGTATAGCTCAGAGGTGCAGTCTTGTTTGCAGTCTACAGTCTCAGCCCTGTCATCCTCTGAGTTAGCTCATGGACTGACCCGTAGACAT
TTATTACGCTGTTTCGTGGTGGTACTTGTGTCACTGCAACTTGAACCCAGTACTGCACTGGACGGCAATTATTTGAAACCTXTACTTAGT
CTTTCCAACCCAGGGCTTTAA
Edits in Original Sequence 
GTCGCCCAAAAGATATACTCTATACTACTGCCGTCTACCGATTTCACCGCTATATATTCATTTCCTATACAATCTGTTTTCGCAGGTTTT
GTTCCAATTTCAAGGTGTTGTTGCTTCCCCAATTCACAGAGAATTGAAATTGGTGAATTTGATATGGCTGGGAAGATTATGCATGCTGTT
CAGTACGACTCTTATGGCGGTGGAGCCGCTGCCTTGAAGCATGT
(5')ATGGCTGGGAAGATTATGCATGCTGTTCAGTACGACTCTTAT
GGCGGTGGAGCCGCTGCCTTGAAGCATGTGGAAGTTCCTGTCCCAACTCCGAAGAAGGATGAGGTCTTGCTAAAACTCGAGGCTGCAAGC
ATAAATCCTGTTGACTGGAAAATTCAGAAGGGCGTGCTTCGTCCCCTTCTTCCTACCAAGTTTCCTTTTATTCCTACTCNCGACGXTGGA
GGAGAAGGTGTTAAGGtNAGGATCTAATGTAAAAAGCTTCAAGGCTGGTGCAAGGGTTGTGGCTXATGCTCAATACCCTGATGGAGGTGG
ATTGGCTGAAXTTGCGGTGGCTATGAGAGTTGAXCTGTTCCAGACCGCTGAGTATAGCTCAGAGGTGCAGTCTTGTTTGCAGTCTACAGT
CTCAGCCCTGTCATCCTCTGAGTTAGCTCATGGACTGACCCGTAGACATTTATTACGCTGTTTCGTGGTGcGTACTTGTGTCACTGCAAC
TTGAACCCAGTACTGCACTGGACGGCAATTATTTGAAACCTXTACTTAGTCTTTCCAACCCAGGGCTTTAA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan