ESTScan Details for Unigene SGN-U339089

Score 
-288
Direction 
Reverse
Predicted Peptide Sequence 
WRGMGPSPPELGDSLPAGELMKKSAPPFPEGKKRRDRYSVKRPGLGPGERHEGVFRGEPPGIFIVRWGFATFDLSVGFCDARQGGGAYGK
TPATAAFLRFLAFCWPFAHMFFPALSPDSVDNRITPLSELIPLAAAERPSAAESVSEEAEERPIRKPPLPAVGRFINAAGTTGFPTGKRA
VSATQLMELAHSLGTPGFTLYASGRMLCGIVTDNNFTQETAMTMITPSLKLTLTKGNKSWSSPAVAAALELVDPRAAGIWHEASS
Predicted Coding Sequence 
XTTTGGAGGGGAATGGGGCCTTCTCCCCCGGAATTGGGGGATTCCCTTCCAGCCGGGGAGCTTATGAAGAAAAGCGCCCCCCCTTTCCCC
GAAGGGAAGAAAAGGCGGGACAGGTATTCCGTTAAGCGGCCAGGGTTGGGACCAGGAGAGCGCCACGAGGGAGTTTTCAGGGGGGAACCC
CCTGGTATTTTTATAGTTCGGTGGGGTTTTGCCACCTTTGACTTGAGCGTTGGTTTTTGTGATGCTCGTCAGGGGGGCGGAGCCTATGGA
AAAACGCCAGCAACXGCGGCCTTTTTACGGTTCCTGGCCTTTTGCTGGCCTTTTGCTCACATGTTCTTTCCTGCGTTATCCCCTGATTCT
GTGGATAACCGTATTACCCCTTTGAGTGAGCTGATACCGCTTGCCGCAGCCGAACGACCGAGCGCAGCXGAGTCAGTGAGCGAGGAAGCG
GAAGAGCGCCCAATACGCAAACCGCCTCTCCCCGCCGTTGGCCGATTCATTAATGCAGCTGGCACGACAGGTTTCCCGACTGGAAAGCGG
GCAGTGAGCGCAACGCAATTAATGGAGTTAGCTCACTCATTAGGCACCCCAGGCTTTACACTTTATGCTTCCGGCCGTATGTTGTGTGGA
ATTGTGACGGATAACAATTTCACACAGGAAACAGCTATGACCATGATTACGCCAAGCTTGAAATTAACCCTCACTAAAGGGAACAAAAGC
TGGAGCTCCCCCGCGGTGGCGGCCGCTTTAGAACTAGTGGATCCCCGGGCTGCAGGAATTTGGCACGAGGCGTCAAGTTAA
Edits in Original Sequence 
(5')XTTTGGAGGGGAATGGGGCCTTCTCCCCCGGAATTGGGGGATTCCCTTCCAGCCGGGGAGCTTATGAAGAAAAGCGCCCCCCCTTT
CCCCGAAGGGAAGAAAAGGCGGGACAGGTATTCCGTTAAGCGGCCAGGGTTGGGACCAGGAGAGCGCCACGAGGGAGTTTTCAGGGGGGA
ACCCCCTGGTATTTTTATAGTTCGGTGGGGTTTTGCCACCTTTGACTTGAGCGTTGGTTTTTGTGATGCTCGTCAGGGGGGCGGAGCCTA
TGGAAAAACGCCAGCAACXGCGGCCTTTTTACGGTTCCTGGCCTTTTGCTGGCCTTTTGCTCACATGTTCTTTCCTGCGTTATCCCCTGA
TTCTGTGGATAACCGTATTACCgCCTTTGAGTGAGCTGATACCGCTTGCCGCAGCCGAACGACCGAGCGCAGCXGAGTCAGTGAGCGAGG
AAGCGGAAGAGCGCCCAATACGCAAACCGCCTCTCCCCGCgCGTTGGCCGATTCATTAATGCAGCTGGCACGACAGGTTTCCCGACTGGA
AAGCGGGCAGTGAGCGCAACGCAATTAATGtGAGTTAGCTCACTCATTAGGCACCCCAGGCTTTACACTTTATGCTTCCGGCtCGTATGT
TGTGTGGAATTGTGAgCGGATAACAATTTCACACAGGAAACAGCTATGACCATGATTACGCCAAGCTTGAAATTAACCCTCACTAAAGGG
AACAAAAGCTGGAGCTCCCCCGCGGTGGCGGCCGCTTTAGAACTAGTGGATcCCCCGGGCTGCAGGAATTTGGCACGAGGCGTCAAGTTA
A(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan