ESTScan Details for Unigene SGN-U339099

Score 
170
Direction 
Forward
Predicted Peptide Sequence 
RAAGSRQGMKEFMNEAKLLARVRTEMWWXGLGYCVHGVEKLLVYEYVANESLDKILFKSANRDALSWKQRHDIIVGIARGLLYLHEGSHT
CIIHRDIKASNILLDDKWVPKIADFGMARLYPEDKTHVNTRVAGTNQWLYGPEYVMYGHLSVKADVFSFGVVILELISGQKNSTFNRDPD
SRSLLEWAVQAVHEGSELGDLDPALPQSAIPDEIAMYITDCFIMHSIGSTTTFNQQQGVGDAIQKILTFGRRTNLTLVFPVKKYNSQTQG
VGPSTKVGNSGGFESLQLGNSLIANTVAGTGVYSNPPRRETDPSGESPVEY
Predicted Coding Sequence 
XCCCGGGCTGCAGGTTCAAGGCAAGGGATGAAGGAATTTATGAATGAAGCTAAGTTGTTGGCTCGTGTACGCACAGAAATGTGGTGGGXT
GGGTTAGGGTACTGTGTACATGGAGTAGAGAAGTTGCTTGTGTATGAGTATGTTGCTAATGAGAGCCTTGACAAAATCCTCTTCAAATCT
GCTAACAGAGATGCACTCAGCTGGAAGCAACGGCATGACATAATTGTTGGCATTGCTAGAGGGTTGCTATACCTTCATGAAGGATCACAT
ACTTGCATTATCCACCGTGACATAAAAGCTAGCAACATCCTACTTGATGACAAATGGGTGCCCAAGATTGCTGATTTCGGAATGGCTAGA
CTCTATCCTGAAGATAAAACACATGTTAACACCCGTGTAGCTGGTACTAACCAGTGGCTATATGGCCCCGAGTACGTTATGTATGGACAT
CTATCAGTGAAGGCTGATGTATTCAGTTTCGGAGTTGTAATTCTGGAGCTCATAAGTGGCCAGAAGAATTCAACCTTTAACAGAGATCCT
GATTCTCGAAGCCTTCTTGAATGGGCXGTACAGGCTGTACACGAAGGGTCGGAGCTTGGAGATTTGGACCCTGCACTGCCACAATCGGCT
ATCCCCGATGAGATAGCAATGTACATTACAGATTGTTTTATTATGCATTCAATCGGATCCACCACTACGTTCAACCAACAACAAGGTGTG
GGTGATGCTATTCAAAAAATCTTGACTTTTGGTAGGAGAACCAACTTGACCCTGGTTTTCCCGGTCAAGAAATATAACTCACAAACCCAG
GGGGTGGGTCCTTCCACAAAAGTGGGAAACTCGGGGGGATTCGAATCTTTACAATTAGGTAATAGTTTAATAGCAAACACTGTTGCTGGA
ACTGGAGTTTATTCCAACCCTCCAAGACGGGAAACGGACCCCTCTGGGGAAAGTCCCGTGGAATATTAA
Edits in Original Sequence 
(5')XCCCGGGCTGCAGGTTCAAGGCAAGGGATGAAGGAATTTATGAATGAAGCTAAGTTGTTGGCTCGTGTACGCACAGAAATGTGGTG
GGXTGGGTTAGGGTACTGTGTACATGGAGTAGAGAAGTTGCTTGTGTATGAGTATGTTGCTAATGAGAGCCTTGACAAAATCCTCTTCAA
ATCTGCTAACAGAGATGCACTCAGCTGGAAGCAACGGCATGACATAATTGTTGGCATTGCTAGAGGGTTGCTATACCTTCATGAAGGATC
ACATACTTGCATTATCCACCGTGACATAAAAGCTAGCAACATCCTACTTGATGACAAATGGGTGCCCAAGATTGCTGATTTCGGAATGGC
TAGACTCTATCCTGAAGATAAAACACATGTTAACACCCGTGTAGCTGGTACTAACCAGTGGCTATATGGCgCCCGAGTACGTTATGTATG
GACATCTATCAGTGAAGGCTGATGTATTCAGTTTCGGAGTTGTAATTCTGGAGCTCATAAGTGGCCAGAAGAATTCAACCTTTAACAGAG
ATCCTGATTCTCGAAGCCTTCTTGAATGGGCXGTACAGGCTGTACACGAAGGGTCGGAGCTTGGAGATTaTGGACCCTGCACTGCCACAA
TCGGCTATCCCCGATGAGATAGCAATGTACATTACAGATTGTTTTATTATGCATTCAATCGGATCCACCACTACGTTCAACCAtACAACA
AGGTGTGGGTGATGCTATTCAAAAAATCTTGAtCTTTTGGTAGGAGAACCAACTTGACCCTGGTTTTCCCGGTCAAGAAATATAACTCAC
AAACCCAGGGGGTGGGTCCTTCCACAAAAGTGGGAAACTCGGGGGGATTCGAATCTTTACAATTaAGGTAATAGTTTAATAGCAAACACT
GTTGCTGGaAACTGGAGTTTATTCCAACCCTCCAAGACGGGAAACGGACCCCTCTGGGGAAAGTCCCGTGGAATATTAA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan