ESTScan Details for Unigene SGN-U339273

Score 
602
Direction 
Forward
Predicted Peptide Sequence 
LAGAPRGGGRSRTSGSPGLQEFGXEDPLTAWSAAARLLRSYYPLITPAGQNGLASALSNASERLPSGTRCADPALPFKGPLTYAGDASIN
GSIPPGRRLVVPLNICVSQGLSLMKARLLSMEIPAHVGEDHSNVQVETSSAEESPRTDRFMKIDPYRGSWGLRFLELELSNPTDVVFEIG
VSVNMEDSNNEENPEYDYPKTRIDRDYTARVLIPLEHFKLPVLDGTYLVKESQMDXTSTRKSSFSEKSSKAELNASIKN
Predicted Coding Sequence 
XXATTAGCTGGAGCTCCCCGCGGTGGCGGCCGCTCTAGAACTAGTGGATCCCCCGGGCTGCAGGAATTCGGCXACGAGGATCCTCTTACT
GCATGGAGTGCAGCAGCACGTCTTCTTAGGTCCTATTATCCTCTTATAACACCTGCTGGGCAAAATGGTCTTGCGAGTGCACTTTCAAAT
GCGTCTGAGAGACTTCCCTCAGGAACTCGCTGTGCTGATCCTGCATTGCCTTTTAAAGGTCCACTTACTTATGCTGGAGATGCATCAATA
AATGGATCTATTCCTCCCGGTAGGCGATTGGTTGTTCCCCTTAATATATGTGTTTCACAGGGGTTATCTCTTATGAAGGCTCGTTTGTTA
TCAATGGAGATCCCTGCTCATGTTGGTGAGGATCATTCAAATGTTCAAGTGGAAACCAGTTCTGCTGAAGAATCCCCTCGTACTGATAGG
TTCATGAAAATTGATCCTTACAGAGGAAGTTGGGGCCTGCGTTTCCTCGAGCTTGAGTTATCCAATCCGACTGATGTTGTCTTCGAGATT
GGCGTGTCTGTCAATATGGAGGATTCTAACAATGAGGAGAATCCTGAGTATGACTATCCTAAAACAAGGATTGACAGAGATTACACTGCC
AGGGTGCTAATACCATTAGAACATTTTAAGTTACCTGTTCTTGATGGTACTTACCTGGTTAAGGAGTCTCAAATGGATANGACCAGTACT
AGAAAATCAAGCTTCTCTGAGAAAAGTAGCAAAGCTGAACTTAATGCTTCCATCAAAAATTAA
Edits in Original Sequence 
(5')XXATTAGCTGGAGCTCCCCGCGGTGGCGGCCGCTCTAGAACTAGTGGATCCCCCGGGCTGCAGGAATTCGGCXACGAGGATCCTCT
TACTGCATGGAGTGCAGCAGCACGTCTTCTTAGGTCCTATTATCCTCTTATAACACCTGCTGGGCAAAATGGTCTTGCGAGTGCACTTTC
AAATGCGTCTGAGAGACTTCCCTCAGGAACTCGCTGTGCTGATCCTGCATTGCCTTTTAtAAGGTCCACTTACTTATGCTGGAGATGCAT
CAATAAATGGATCTATTCCTCCCGGTAGGCGATTGGTTGTTCCCCTTAATATATGTGTTTCACAGGGGTTATCTCTTATGAAGGCTCGTT
TGTTATCAATGGAGATCCCTGCTCATGTTGGTGAGGATCATTCAAATGTTCAAGTGGAAACCAGTTCTGCTGAAGAATCCCCTCGTACTG
ATAGGTTCATGAAAATTGATCCTTACAGAGGAAGTTGGGGCCTGCGTTTCCTCGAGCTTGAGTTATCCAATCCGACTGATGTTGTCTTCG
AGATTGGCGTGTCTGTCAATATGGAGGATTCTAACAATGAGGAGAATCCTGAGTATGACTATCCTAAAACAAGGATTGACAGAGATTACA
CTGCCAGGGTGCTAATACCATTAGAACATTTTAAGTTACCTGTTCTTGATGGTACTTACCTGGTTAAGGAGTCTCAAATGGATANGACCA
GTACTAGAAAATCAAGCTTCTCTGAGAAAAGTAGCAAAGCTGAACTTAATGCTTCCATCAAAAATTAA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan