ESTScan Details for Unigene SGN-U339277

Score 
381
Direction 
Forward
Predicted Peptide Sequence 
SKSWNLTAVAXRSRTSGSPGLQEFGTRHPYIGFPKKQETFARISGYCEQNDIHSPCLTILESLLFSAWLRLPSEVDVETQKAFVDEVMEL
VELSPLRGALVGLPGVDGLSTEQRKRLTIAVELVANPSIVFMDEPTSGLDARAAAIVMRTVRNIVNTGRTIVCTIHQPSIDIFESFDELL
FMKRGGELIYAGPLGPKSCQLIEYFEAIEGXTQNKTLDIIQLMGCWEVTFVSRRNSTWVFDFAEIYPKIKPFFNKSSFWVEKLNRFTVAN
SKDIEXSLPXIWASLNLSQVLSLAFWEX
Predicted Coding Sequence 
TCAAAAAGCTGGAACCTCACCGCGGTGGCGGNCCGCTCTAGAACTAGTGGATCCCCCGGGCTGCAGGAATTCGGCACGAGGCATCCATAT
ATCGGGTTCCCAAAGAAGCAAGAAACGTTTGCTAGAATATCTGGCTACTGTGAGCAAAATGACATCCACTCACCTTGCTTGACCATTCTT
GAATCACTACTGTTTTCTGCTTGGCTACGTTTGCCATCAGAGGTTGACGTAGAGACACAAAAGGCATTTGTTGACGAGGTAATGGAGCTT
GTGGAGCTGAGTCCACTAAGAGGAGCTTTGGTTGGTTTGCCTGGAGTTGATGGACTGTCAACAGAACAAAGGAAACGGCTAACAATTGCT
GTTGAACTAGTAGCTAACCCTTCTATTGTGTTCATGGATGAACCTACATCTGGATTGGATGCAAGAGCTGCAGCTATTGTAATGAGGACT
GTACGTAACATTGTGAACACCGGCCGAACAATTGTTTGCACAATCCACCAGCCCAGCATTGACATTTTTGAATCATTTGATGAGCTNTTG
TTTATGAAGCGTGGAGGAGAGCTCATTTATGCAGGACCTCTTGGTCCTAAATCTTGCCAGTTGATAGAGTATTTTGAGGCAATTGAAGGA
GXTACCCAGAATAAGACCCTGGATATAATCCAGCTCATGGGATGTTGGGAGGTTACCTTCGTCAGTAGAAGAAACTCGACTTGGGTGTTT
GATTTTGCAGAAATTTACCCAAAGATCAAACCCTTTTTCAATAAATCAAGTTTTTGGGTTGAAAAGCTAAACAGGTTCACGGTGGCGAAT
TCAAAAGATATTGAAXTTTCCCTGCCTAANATTTGGGCAAGTCTTAATTTAAGCCAAGTCCTAAGCTTGGCCTTTTGGGAGAXX
Edits in Original Sequence 
(5')TCAAAAAGCTGGAACCTCACCGCGGTGGCGGNCCGCTCTAGAACTAGTGGATCCCCCGGGCTGCAGGAATTCGGCACGAGGCATCC
ATATATCGGGTTaCCCAAAGAAGCAAGAAACGTTTGCTAGAATATCTGGCTACTGTGAGCAAAATGACATCCACTCACCTTGCTTGACCA
TTCTTGAATCACTACTGTTTTCTGCTTGGCTACGTTTGCCATCAGAGGTTGACGTAGAGACACAAAAGGCATTTGTTGACGAGGTAATGG
AGCTTGTGGAGCTGAGTCCACTAAGAGGAGCTTTGGTTGGTTTGCCTGGAGTTGATGGACTGTCAACAGAACAAAGGAAACGGCTAACAA
TTGCTGTTGAACTAGTAGCTAACCCTTCTATTGTGTTCATGGATGAACCTACATCTGGATTGGATGCAAGAGCTGCAGCTATTGTAATGA
GGACTGTACGTAACATTGTGAACACCGGCCGAACAATTGTTTGCACAATCCACCAGCCCAGCATTGACATTTTTGAATCATTTGATGAGC
TNTTGTTTATGAAGCGTGGAGGAGAGCTCATTTATGCAGGACCTCTTGGTCCTAAATCTTGCCAGTTGATAGAGTATTTTGAGGCAATTG
AAGGAGXTACCCAGAATAAGACCCTGGATATAATCCAGCTCATGGGATGTTGGGAGGTTACCTTCGTCAGTAGAAGAAACTCGACTTGGG
TGTTTGATTTTGCAGAAATTTACCCAAAGATCAAACCCTTTTTCAtATAAATCAAGTTTTTGGGTTGAAAAGCTAAACAGGTTCACGGTG
GCGAATTCAAAAGATATTGAAXTTTCCCTGCCTAANATTTGGGCAAGTCTTAATTTAAGCCAAGTCCTAAGCTTGGCCTTTTGGGAGAXX
(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan