ESTScan Details for Unigene SGN-U339315

Score 
684
Direction 
Forward
Predicted Peptide Sequence 
MAVKDKKPSVEINNLKFTYPGIDGHPPPGSTPLIGDFNLTLYPGDRCLLVGSNGAGKTTILKILGGKHMVEPDMVRVLGRSAFHDTALTA
SGDLSYLGGEWRREVAFAGFEVPIQMDVSAEKMIFGVPGTDPQRRDELIKVLGINLSWRMHRSSDGQRRRVQICMGLLKPFKVLLLDEIT
VDLDVLAEADXLKILIKECEERGATNNDATTFLMFLRIALSFKYVANGKLLSIAKGRVX
Predicted Coding Sequence 
ATGGCGGTAAAGGACAAAAAGCCATCAGTAGAGATCAACAATCTCAAGTTCACCTATCCTGGTATAGATGGACATCCGCCTCCCGGATCT
ACCCCTTTGATAGGTGATTTCAACCTTACCCTTTATCCTGGTGATCGATGCCTTCTTGTCGGATCTAATGGCGCAGGGAAGACTACAATC
CTGAAGATATTGGGAGGAAAGCATATGGTAGAACCAGACATGGTCAGAGTCCTTGGAAGATCTGCATTTCATGACACTGCTTTGACGGCT
TCTGGAGACCTCAGTTATCTTGGTGGAGAGTGGAGGAGGGAAGTTGCGTTTGCTGGATTTGAGGTGCCTATCCAAATGGATGTTTCTGCT
GAGAAAATGATTTTTGGGGTTCCAGGTACTGATCCACAAAGACGAGACGAACTAATTAAGGTTCTTGGTATCAATCTGTCCTGGAGAATG
CACAGATCATCTGATGGGCAAAGAAGAAGAGTGCAGATATGTATGGGTCTTCTGAAACCATTCAAGGTACTACTTCTCGATGAGATAACA
GTTGATCTAGATGTTCTTGCAGAGGCTGATCNTTTGAAAATTCTGATCAAAGAATGTGAAGAGCGAGGCGCTACXAATAATGATGCCACA
ACATTTTTGATGTTCTTGAGAATTGCCCTCTCATTTAAATATGTGGCTAATGGGAAGCTGCTTAGCATTGCAAAGGGTAGGGTGTXX
Edits in Original Sequence 
GCTGTGCCGCATTTCATAGAACACTTGAAAGATTATGGCGGTAAAGGACAAAAAGCCATCAGTAGAGATCAACAATCTCAAGTTCACCTA
TCCT
(5')ATGGCGGTAAAGGACAAAAAGCCATCAGTAGAGATCAACAATCTCAAGTTCACCTATCCTGGTATAGATGGACATCCGCCTC
CCGGATCTACCCCTTTGATAGGTGATTTCAACCTTACCCTTTATCCTGGTGATCGATGCCTTCTTGTCGGATCTAATGGCGCAGGGAAGA
CTACAATCCTGAAGATATTGGGAGGAAAGCATATGGTAGAACCAGACATGGTCAGAGTCCTTGGAAGATCTGCATTTCATGACACTGCTT
TGACGGCTTCTGGAGACCTCAGTTATCTTGGTGGAGAGTGGAGGAGGGAAGTTGCGTTTGCTGGATTTGAGGTGCCTATCCAAATGGATG
TTTCTGCTGAGAAAATGATTTTTGGGGTTCCAGGTACTGATCCACAAAGACGAGACGAACTAATTAAGGTTCTTGGTATCAATCTGTCCT
GGAGAATGCACAGATCATCTGATGGGCAAAGAAGAAGAGTGCAGATATGTATGGGTCTTCTGAAACCATTCAAGGTACTACTTCTCGATG
AGATAACAGTTGATCTAGATGTTCTTGCAGAGGCTGATCNTTTGAAAATTCTGATCAAAGAATGTGAAGAGCGAGGCGCTACXAATAATG
ATGCCACAACATTTTTGATGTTCTTGAGAATTGCCCTCTCATTTAAATATGTGGCTAATGGGAAGCTGCaTTAGCATTGCAAAGGGTAGG
GTGTXX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan