ESTScan Details for Unigene SGN-U339330

Score 
-671
Direction 
Reverse
Predicted Peptide Sequence 
GTGGPPVKGGGANLKTPPGRGFFVGFMGARGGTPVNNFGQGPLRGPGSLFGFFSLSFFWPRLAGVFPRQGFKLGGXPLGFRFSALRHLDP
KKLDWGMVHVVGHRPDRRFFPFDVGATFFNSGLLFQTGTTLNPISVYFFDXIRDFADLAYWLKNELINKNLTRILQNINAYNLPFAIQGA
QLLGRAIGAGLFAITPAGERGMCCKAIKLGNARVFPVTTL
Predicted Coding Sequence 
GGAACGGGGGGCCCCCCTGTAAAAGGCGGXGGCGCCAATTTAAAAACACCCCCXGGACGGGGGTTTTTCGTTGGGTTTATGGGCGCAAGG
GGGGGGACCCCGGTAAACAATTTTGGCCAAGGGCCCCTAAGGGGCCCCGGGTCCCTTTTTGGTTTTTTTTCCCTTTCCTTTTTTTGGCCA
CGTTTGGCCGGGGTTTTCCCCCGTCAAGGTTTTAAATTGGGGGGCTXCCCTTTAGGGTTTCGATTTAGTGCTTTACGGCACCTCGACCCC
AAAAAACTTGATTGGGGGATGGTTCACGTAGTGGGCCATCGCCCTGATAGACGGTTTTTCCCCTTTGACGTTGGAGCCACGTTCTTTAAT
AGTGGACTTTTGTTCCAAACTGGAACAACACTCAACCCTATCTCGGTTTATTTTTTTGATTTXATAAGGGATTTTGCCGATTTGGCCTAT
TGGTTAAAAAATGAGCTGATTAACAAAAATTTAACGCGAATTTTACAAAATATTAACGCTTACAATTTGCCATTCGCCATTCAGGGTGCG
CAACTGTTGGGAAGGGCGATCGGTGCGGGCCTTTTCGCTATTACGCCAGCTGGCGAAAGGGGGATGTGCTGCAAGGCGATTAAGTTGGGT
AACGCCAGGGTTTTCCCAGTCACGACGTTGTAA
Edits in Original Sequence 
TTTTTTTTTTTTTTTTTTTTTTTTTTTTTTAAAAAAGTGGCAGCTTAGATTTACCCAGGTTATTCTACTGTCCAGAAAGAATCAAGTGGA
TCCTCATTTT
(5')GGAACGGGGGGCCCCCCTGTAAAAGGCGGXGGCGCCAATTTAAAAACACCCCCXGGACGGGGGTTTTTCGTTGGGT
TTATaGGGCGCAAGGGGGGGGACCCCGGTAAACAATTTTGGCCAAGGGCCCCTAAGGGGCCCCGGGTCCCTTTTTGGTTTTTTTTCCCTT
TCCTTTTTTTGGCCACGTTTGGCCGGGGTTTTCCCCCGTCAAGGTTTTAAATTGGGGGGCTXCCCTTTAGGGTTTCGATTTAGTGCTTTA
CGGCACCTCGACCCCAAAAAACTTGATTaGGGGGATGGTTCACGTAGTGGGCCATCGCCCTGATAGACGGTTTTTCgCCCTTTGACGTTG
GAGtCCACGTTCTTTAATAGTGGACTTTTGTTCCAAACTGGAACAACACTCAACCCTATCTCGGTTTATTTTTTTGATTTXATAAGGGAT
TTTGCCGATTTcGGCCTATTGGTTAAAAAATGAGCTGAtTTAACAAAAATTTAACGCGAATTTTaACAAAATATTAACGCTTACAATTTG
CCATTCGCCATTCAGGGTGCGCAACTGTTGGGAAGGGCGATCGGTGCGGGCCTTTTCGCTATTACGCCAGCTGGCGAAAGGGGGATGTGC
TGCAAGGCGATTAAGTTGGGTAACGCCAGGGTTTTCCCAGTCACGACGTTGTAA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan