ESTScan Details for Unigene SGN-U339332

Score 
-83
Direction 
Forward
Predicted Peptide Sequence 
RKEITQLKNPTTIEGNEVIMAPEDCDGWGRGRGHGGHGPHXAITTDAKNTTQAMKLNATLETLKAITFSFFXNSNIAFNLFYSQLVLLVE
NIILFFLGLVPNSCSPGDPLIVEGPATAVELQPLFPLVRGKFELWLIKGITVFCXKLLSARXVPTIYEPGSLRVKPGGAQGVSELIFKGV
ALSGAFSRWGNCPACGIKKWAKSGGEGFSANRPLS
Predicted Coding Sequence 
AGGAAAGAAATAACCCAACTGAAAAATCCCACCACCATTGAAGGCAATGAGGTGATTATGGCACCGGAGGATTGCGATGGATGGGGGCGG
GGGCGGGGGCATGGTGGTCATGGCCCTCATGXAGCTATTACAACCGACGCTAAAAATACCACTCAAGCAATGAAGTTGAATGCAACACTT
GAAACTTTGAAAGCCATTACTTTCTCGTTTTTCAAXAATTCAAATATTGCCTTCAACTTGTTTTATTCTCAACTTGTTTTATTGGTTGAG
AATATAATTTTATTTTTTTTAGGGCTCGTGCCGAATTCCTGCAGCCCAGGGGATCCACTAATTGTAGAGGGGCCGGCCACCGCXGTGGAG
CTACAACCTTTGTTCCCTTTAGTGAGGGGTAAATTCGAGCTTTGGCTAATCAAGGGCATAACTGTTTTCTGCCXGAAATTGTTGTCCGCC
CGCCAXGTTCCCACCATTTACGAACCCGGAAGCTTAAGGGTAAAACCTGGGGGAGCCCAAGGAGTGAGCGAACTTATTTTTAAGGGGGTG
GCCCTTAGTGGCGCGTTTTCAAGATGGGGAAACTGTCCGGCGTGTGGAATAAAGAAATGGGCAAAAAGCGGGGGAGAGGGGTTCTCCGCG
AATAGGCCCCTCTCC
Edits in Original Sequence 
GCTTGTGATTTAATGACTCAACTTGAACATATTTGATACGATTTCCTAATTTTGAGAAAAGAGTACAAACAACTTGCCATGGTACAACAA
TTAAACCCATTGAAAAGCGATTCAAAAAAAAAGGTCAAGAACCTCTCCAACGTATCATAATGAATCGTAAACTCCAAAGACAAAGATGAC
CATAAACATTTAAACTTTAAACTCTCTCCTTAATAACAAGGAAAGAAATAACCCAACTGAAAAATCCCACCACCATTGAAGGCAATGAGG
TGA
(5')AGGAAAGAAATAACCCAACTGAAAAATCCCACCACCATTGAAGGCAATGAGGTGATTATGGCACCGGAGGATTGCGATGGATa
GGGGGCGGGGGCGGGGGCATGGTGGTCATGGCCCTCATGXAGCTATTACAACCGACGCTAAAAATACCACTCAAGCAATGAAGTTGAATG
CAACACTTGAAACTTTGAAAGCCATTACTTTCTCGTTTTTCAAXAATTCAAATATTGCCTTCAACTTGTTTTATTCTCAACTTGTTTTAT
TGGTTGAGAATATAATTTTATTTTTTTTAGGGCTCGTGCCGAATTCCTGCAGCCCAGGGGATCCACTAATTGTAGAGGGGCCGGCCACCG
CXGTGGAGCTACAACCTTTGTTCCCTTTAGTGAGGGGTAAATTCGAGCTTTGGCTAATCAAGGGCATAACTGTTTTCTGCCXGAAATTGT
TGTCCGCCCGCCAXGTTCCCACCATTTACGAACCCGGAAGCTTAAGGGTAAAACCTGGGGGAGCCCAAGGAGTGAGCGAACTTATTTTTA
AGGGGGTGGCCCTTAGTGGCGCGTTTTCAAGATGGGGAAACTGTCCGGaCGTGTGGAATAAAGAAATGGGCAAAAAGCGGGGGAGAGGGG
TTCTCCGCGAATAGGCCCCTCTCC(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan