ESTScan Details for Unigene SGN-U339337

Score 
253
Direction 
Forward
Predicted Peptide Sequence 
MVKLVQQSWWKLRTCFVRVSSSSYSTIAETIASLDLTNKDEQICKPLTSDALYNRLLYLNRSKESVISVLEKWDTEQNPIKYEELLSIIK
QLRSYSRYKQALQIFEWMKKSKNFDISPRDFAXLTGFSIKSPWSGNCRDX
Predicted Coding Sequence 
ATGGTGAAACTTGTTCAACAATCATGGTGGAAATTGAGAACTTGTTTTGTTAGGGTTTCTTCTTCTTCATATTCTACAATAGCTGAAACT
ATAGCCTCCTTAGATTTGACTAATAAAGATGAACAAATTTGTAAACCGTTAACCTCGGATGCTCTGTACAATAGGCTACTCTATTTGAAT
CGCTCTAAGGAATCCGTCATATCAGTACTGGAGAAATGGGATACTGAACAAAATCCCATTAAGTATGAAGAACTACTGAGTATCATCAAA
CAACTTAGATCTTACAGTCGATACAAGCAGGCCCTTCAGATTTTTGAGTGGATGAAGAAGTCCAAGAATTTTGATATATCGCCTAGAGAT
TTTGCAGXTCTAACTGGATTTAGTATCAAAAGCCCATGGTCTGGAAACTGCAGAGACAXX
Edits in Original Sequence 
GAAATGAAGAGTGAAATAGTGAGACATATGCTCTGCATTTCTGGTAAGAATGGTGAAACTTGTTCAACAATCATGGTGGAAATTGAGAAC
TTGTTTTGTTAGG
(5')ATGGTGAAACTTGTTCAACAATCATGGTGGAAATTGAGAACTTGTTTTGTTAGGGTTTCTTCTTCTTCATATT
CTACAATAGCTGAAACTATAGCCTCCTTAGATTTGACTAATAAAGATGAACAAATTTGTAAACCGTTAACCTCGGATGCTCTGTACAATA
GGCTACTCTATTTGAATCGCTCTAAGGAATCCGTCATATCAGTACTGGAGAAATGGGATACTGAACAAAATCCCATTAAGTATGAAGAAC
TACTGAGTATCATCAAACAACTTAGATCTTACAGTCGATACAAGCAGGCCCTTCAGATTTTTGAGTGGATGAAGAAGTCCAAGAATTTTG
ATATATCGCCTAGAGATTTTGCAGXTCTAACTGGATTTAGTATCAAAAGCCCATGGTCTGGAAACTGCAGAGACAXX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan