ESTScan Details for Unigene SGN-U339429

Score 
339
Direction 
Reverse
Predicted Peptide Sequence 
MPLIKVVYDTLAEGLEWAHCDSFDMWRPLLHAQKLVHQAELALFCCPSPAGXYRIKVSPETESXDQSGTYPRSHIGEVNSSSEXGIAGIA
KLDKATKKVEESLILVDVFWCLFDSSDYKQKRSLSENKVGINLKHQVTNNDFKAAAIVIKNKQMLKPAPANLQKVSFYYLITSPQKGNNN
NYKSVTNHRIHLRVHHFXPATRSSFTRSSNLEISFGVKTSSNNLRPXHNIHHMSFDWFPRAEFLQPGGSTSSRAAATAVELKSS
Predicted Coding Sequence 
ATGCCACTGATCAAGGTGGTTTATGACACXCTTGCAGAAGGGCTGGAATGGGCTCATTGTGACTCTTTTGACATGTGGCGTCCTCTTTTA
CATGCTCAAAAATTGGTGCACCAAGCTGAATTAGCTCTCTTTTGCTGCCCTTCACCTGCTGGTXTGTACAGAATAAAAGTTTCACCTGAA
ACAGAGTCAXCAGATCAATCAGGAACTTATCCAAGATCACATATTGGAGAAGTAAATAGTTCATCAGAAXTTGGCATTGCTGGTATCGCA
AAACTTGACAAGGCTACCAAAAAAGTAGAAGAAAGTTTAATTTTAGTTGATGTTTTTTGGTGCTTGTTTGATTCATCAGATTATAAGCAA
AAGAGAAGTTTAAGTGAAAACAAAGTTGGTATCAACCTCAAGCACCAAGTCACAAACAATGATTTTAAGGCAGCTGCAATTGTCATAAAG
AATAAACAAATGCTCAAACCTGCTCCAGCAAACCTACAGAAGGTGTCCTTTTACTATCTCATAACTTCGCCCCAAAAAGGAAACAACAAT
AACTATAAAAGCGTCACGAATCACAGGATCCACCTGAGAGTTCACCATTTTGXACCAGCAACTCGAAGTTCATTCACAAGGTCATCTAAT
CTAGAGATTTCATTTGGAGTAAAAACGTCTTCGAATAACTTGAGACCTXCTCACAACATTCACCATATGTCCTTTGACTGGTTCCCTCGT
GCCGAATTCCTGCAGCCCGGGGGATCCACTAGTTCTAGAGCGGCCGCCACCGCGGTGGAGCTCAAGAGTTCG
Edits in Original Sequence 
GTGCACCAAGCTGAATTAGCTCTCTTTTGCTGCCCTTCACCTGCTGGTTGTACAGAATAAAAGTTTCACCTGAAACAGAGTCACAGATCA
ATCAGGAACTTATCCAAGATCACATATTGGAGAAGTAAATAGTTCATCAGAATTGGCATTGCTGGTATCGCAAAACTTGACAAGGCTACC
AAAAAAGTAGAAGAAAGTTTAATTTTAGTTGATGTTTT
(5')ATGCCACTGATCAAGGTGGTTTATGACACXCTTGCAGAAGGGCTGGAA
TGGGCTCATTGTGACTCTTTTGACATGTGGCGTCCTCTTTTACATGCTCAAAAATTGGTGCACCAAGCTGAATTAGCTCTCTTTTGCTGC
CCTTCACCTGCTGGTXTGTACAGAATAAAAGTTTCACCTGAAACAGAGTCAXCAGATCAATCAGGAACTTATCCAAGATCACATATTGGA
GAAGTAAATAGTTCATCAGAAXTTGGCATTGCTGGTATCGCAAAACTTGACAAGGCTACCAAAAAAGTAGAAGAAAGTTTAATTTTAGTT
GATGTTTTTTGGTGCTTGTTTGATTCATCAGATTATAAGCAAAAGAGAAGTTTAAGTGAAAACAAAGTTaGGTATCAACCTCAAGCACCA
AGTCACAAACAATGATTTTAAGGCAGCTGCAATTaGTCATAAAGAATAAACAAATGCTCAAACCTGCTCCAGCAAACCTACAGAAGGTGT
CCTTTTACTATCTCATAACTTCGCCCCAAAAAGGAAACAACAATAACTATAAAAGCGTCACGAATCACAGGATCCACCTGAGAGTTCACC
ATTTTGXACCAGCAACTCGAAGTTCATTCACAAGGTCATCTAATCTAGAGATTTCATTTGGAGTAAAAACGTCTTCGAATAACTTGAGAC
CTXCTCACAACATTCACCATATGTCCTTTGACTGGTTCCCTCGTGCCGAATTCCTGCAGCCCGGGGGATCCACTAGTTCTAGAGCGGCCG
CCACCGCGGTGGAGCTCAAGAGTTCG(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan