ESTScan Details for Unigene SGN-U339487

Score 
213
Direction 
Reverse
Predicted Peptide Sequence 
QAARPSFKLKRRKAGKKRPQIPEKPAFFPGGFGRFHLSSWAGQVFPDWKSGAVRATPINXELAPLIXAPQALHFMLPARMLCGIVTDNNF
TQETAMTMITPSSKLTLTKGNKSWSSTAVAAAXRTSGSPGLQEFGRGKNALKDDTNKIIMKNILGSNDDNNNNNHNLKKTSMGINFMSQN
GIIRSKKIIKKSCKISRRARKIISPNIIAKKMVKKRTKVLQSLVPGGEYMDDASLIKETLDYIISLRVQVDVMRHLANNASYHEINDPKT
RL
Predicted Coding Sequence 
XCCCAAGCCGCACGNCCGAGTTTTAAGTTGAAGCGAAGGAAAGCCGGAAAGAAGCGCCCCCAAATTCCGGAAAAACCCGCTTTTTTCCCC
GGGGGGTTTGGCCGATTTCATTTAAGCAGTTGGGCAGGACAGGTTTTCCCCGATTGGAAAAGCGGGGCAGTGAGGGCAACGCCAATTAAT
GXTGAGTTAGCTCCACTCATTAXGGCCCCCCAGGCTTTACACTTTATGCTTCCGGCTCGTATGTTGTGTGGAATTGTGACGGATAACAAT
TTCACACAGGAAACAGCTATGACCATGATTACGCCAAGCTCGAAATTAACCCTCACTAAAGGGAACAAAAGCTGGAGCTCCACCGCGGTG
GCGGCCGCTXCTAGAACTAGTGGATCCCCCGGGCTGCAGGAATTCGGCAGAGGGAAAAATGCTTTAAAAGATGACACAAACAAAATCATC
ATGAAAAATATTCTTGGATCAAATGATGATAACAATAATAATAATCATAATTTGAAGAAAACTTCAATGGGAATTAATTTTATGTCTCAA
AATGGAATTATTAGAAGCAAGAAGATTATCAAAAAGAGTTGCAAAATTTCAAGAAGAGCAAGAAAAATTATTTCTCCAAATATTATTGCA
AAAAAAATGGTGAAAAAAAGAACAAAAGTTCTTCAAAGTCTTGTTCCTGGTGGAGAATATATGGATGATGCTTCTTTAATTAAAGAAACC
CTAGATTATATTATTTCATTAAGAGTTCAAGTTGATGTTATGAGGCATCTAGCTAATAATGCTAGTTATCATGAGATTAATGATCCCAAA
ACAAGGTTGTAG
Edits in Original Sequence 
(5')XCCCAAGCCGCACGNCCGAGTTTTAAGTTGAAGCGAAGGAAAGCCGGAAAGAAGCGCCCCCAAATTCCGGAAAAACCCGCTTTTTT
CCCCGGGGGGTTTGGCCGATTTCATTTAAtGCAGTTGGGCAGGACAGGTTTTCCCCGATTGGAAAAGCGGGGCAGTGAGGcGCAACGCCA
ATTAATGXTGAGTTAGCTCCACTCATTAXGGCCCCCCAGGCTTTACACTTTATGCTTCCGGCTCGTATGTTGTGTGGAATTGTGAgCGGA
TAACAATTTCACACAGGAAACAGCTATGACCATGATTACGCCAAGCTCGAAATTAACCCTCACTAAAGGGAACAAAAGCTGGAGCTCCAC
CGCGGTGGCGGCCGCTXCTAGAACTAGTGGATCCCCCGGGCTGCAGGAATTCGGCAcGAGGGAAAAATGCTTTAAAAGATGACACAAACA
AAATCATCATGAAAAATATTCTTGGATCAAATGATGATAACAATAATAATAATCATAATTTGAAGAAAACTTCAATGGGAATTAATTTTA
TGTCTCAAAATGGAATTATTAGAAGCAAGAAGATTATCAAAAAGAGTTGCAAAATTTCAAGAAGAGCAAGAAAAATTATTTCTCCAAATA
TTATTGCAAAAAAAATGGTGAAAAAAAGAACAAAAGTTCTTCAAAGTCTTGTTCCTGGTGGAGAATATATGGATGATGCTTCTTTAATTA
AAGAAACCCTAGATTATATTATTTCATTAAGAGTTCAAGTTGATGTTATGAGGCATCTAGCTAATAATGCTAGTTATCATGAGATTAATG
ATCCCAAAACAAGGTTGTAG(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan