ESTScan Details for Unigene SGN-U339540

Score 
170
Direction 
Forward
Predicted Peptide Sequence 
GAPRGGGRSRTSGSPXAAGRDSMEKVKSIQEKLLAAQSRQKEYADRKVRDLEFMEGEQVLLKVSPMKGVMRFRKRGKLSPRYIGPFEVLK
RVGEVAYELALPPGLSGVHPVFHVSMLKRYHGDGNYIIRWDSVSLGENWTYEEEPVAILDREVRKLRSREIASIKVQWKNRPVEEATWEK
EADMQEKYPHLFTDSGTPFRHCFSSFDRSGTNDG
Predicted Coding Sequence 
GGAGCTCCCCGCGGTGGCGGCCGCTCTAGAACTAGTGGATCCCCCGXGGCTGCAGGAAGAGATTCGATGGAGAAAGTGAAGTCTATTCAA
GAAAAGCTTCTAGCGGCGCAAAGTAGACAAAAAGAATATGCAGATCGAAAGGTTAGAGACTTAGAGTTCATGGAGGGCGAACAAGTCTTG
TTGAAAGTCTCGCCAATGAAAGGGGTGATGCGGTTTCGTAAAAGAGGTAAGTTAAGTCCAAGGTATATTGGACCATTTGAGGTACTAAAG
CGAGTAGGGGAGGTGGCTTATGAATTAGCCTTACCTCCAGGGCTGTCCGGAGTACATCCGGTATTTCATGTATCCATGTTGAAAAGATAC
CATGGAGATGGAAACTACATCATCCGTTGGGATTCAGTTTCGCTTGGTGAGAATTGGACTTATGAGGAGGAACCAGTTGCTATTTTAGAT
AGAGAGGTTCGCAAGTTGAGGTCGAGAGAAATTGCATCCATCAAAGTTCAATGGAAGAATCGACCGGTTGAAGAAGCTACTTGGGAGAAG
GAGGCAGATATGCAAGAAAAATACCCACATCTGTTTACAGATTCAGGTACTCCTTTTCGCCATTGTTTTTCTTCATTTGATCGTTCGGGG
ACGAACGATGGGTAA
Edits in Original Sequence 
(5')GGAGCTCCCCGCGGTGGCGGCCGCTCTAGAACTAGTGGATCCCCCGXGGCTGCAGGAAGAGATTCGATGGAGAAAGTGAAGTCTAT
TCAAGAAAAGCTTCTAGCGGCGCAAAGTAGACAAAAAGAATATGCAGATCGAAAGGTTAGAGACTTAGAGTTCATGGAGGGCGAACAAGT
CTTGTTGAAAGTCTCGCCAATGAAAGGGGTGATGCGGTTTCGTAAAAGAGGTAAGTTAAGTCCAAGGTATATTGGACCATTTGAGGTACT
AAAGCGAGTAGGGGAGGTGGCTTATGAATTAGCCTTACCTCCAGGGCTGTCCGGAGTACATCCGGTATTTCATGTATCCATGTTGAAAAG
ATACCATGGAGATGGAAACTACATCATCCGTTGGGATTCAGTTTCGCTTGGTGAGAATTGGACTTATGAGGAGGAACCAGTTGCTATTTT
AGATAGAGAGGTTCGCAAGTTGAGGTCGAGAGAAATTGCATCCATCAAAGTTCAATGGAAGAATCGACCGGTTGAAGAAGCTACTTGGGA
GAAGGAGGCAGATATGCAAGAAAAATACCCACATCTGTTTACAGATTCAGGTACTCCTTTTCGCCATTGTTTTTCTTCATTTGATCGTTC
GGGGACGAACGATGGGTAA(3')GAAAAACTGGCCAAGACCACGGGCACTGCGACGGACCGTCACAGGCACGACGGCCCGTCGAAGGTGC
ATCGTTTCAGCATACTTAGAATTTCTGAATTTGGATATGAAAATCGACTCTCTTTAATTTTGTGACGACCTGCAGACGTGCCATCACATC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan