ESTScan Details for Unigene SGN-U339611

Score 
318
Direction 
Forward
Predicted Peptide Sequence 
METAQVLKFIXVSQVTEYKGNYKPESEEDYNNMYWGRTELMDGEDGEMSWFNAGFEFVLGLALAFVX
Predicted Coding Sequence 
ATGGAAACTGCACAGGTTCTGAAGTTCATTGXTGTTTCACAGGTAACAGAATACAAAGGAAACTACAAACCAGAAAGCGAAGAAGACTAC
AACAACATGTACTGGGGACGAACAGAACTTATGGATGGTGAAGACGGAGAAATGTCCTGGTTCAATGCTGGGTTCGAGTTTGTGTTGGGA
TTGGCCTTGGCATTTGTGTAN
Edits in Original Sequence 
GGTCACGTGCTATCCATCTTTCATGATTAACTTTAGAAATGCTATGATATATGAATTCTGCTTCTTATGATAACACTTAGCTCCTTGCTC
TGATGTTGTGTGATTGAATAGTGCCATCCAGTTTTGTTCTTACATTTTTTTGCACTCCATATGGCAACCTTAGTGACATTTGTTTCTTTT
GGGATATCGAATCCATTACGTGACGCATATTAGCTTGTTATACGTCAACGTTGTTCCAAACTCAAGTTGACTTTTCTTGAAAGTAAATCC
AAAGTTTGAAATTTTCAGCTCATGTGTAAGTATTGCCTATGTGCTGCTTTAATTTTGAAGTTGACAAAAATTAGTTGCATTTCATCTACA
GTTTCTGATTGTTAAGTTTTCTGTGTCGTTTCGATTGAAAAATATTATCATGGCAGTGGTTGGTTTTAGTAATTCTTTAGTACTTGTTTA
TTTTGAACCACAAAGTAGAGTTCCACAGGTGCAATTAATTAGATGAATCCCACAGCTTCTCAGATGTGTAATTACATGATGGAAACTGCA
CAGGTTCTGAAGTTCATTGTGTTTCACAGGTAACAGAATACAAAGGAAACTACAAACCAGAAAGCGAAG
(5')ATGGAAACTGCACAGGT
TCTGAAGTTCATTGXTGTTTCACAGGTAACAGAATACAAAGGAAACTACAAACCAGAAAGCGAAGAAGACTACAACAACATGTACTGGGG
ACGAACAGAACTTATGGATGGTGAAGACGGAGAAATGTCCTGGTTCAATGCTGGGTTCGAGTTTGTGTTGGGATTGGCCTTGGCATTTGT
GTAN(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan