ESTScan Details for Unigene SGN-U339648

Score 
-537
Direction 
Forward
Predicted Peptide Sequence 
MVIAVSCVKLLSLTIPHNIRAGSINVKPGVPNDELTHINCVALTARFPVGKPVVPAAINESANAAGRGGLRIGRSSASSLTXLAALGRSA
AAAVSAHSKAVIRLSTESGDNXRKEHVSKRPAKGQEPKKAALLAFFHRLRPPDEHHKNXTLKSEVAKPDRTIKIPGVSPWKLPRASPVPT
LPLTGYLSAFLPSGSVALSHSSAVGISIRGGPSLPAGLGAQTPVQPDRWALIR
Predicted Coding Sequence 
ATGGTCATAGCTGTTTCCTGTGTGAAATTGTTATCCCTCACAATTCCACACAACATACGAGCCGGAAGCATAAATGTAAAGCCTGGGGTG
CCTAATGATGAGCTAACTCACATTAATTGCGTTGCGCTCACTGCCCGCTTTCCAGTCGGGAAACCTGTCGTGCCAGCTGCXATTAATGAA
TCGGCCAACGCXGCGGGGAGAGGCGGTTTGCGTATTGGGCGCTCTTCCGCTTCCTCGCTCACTGAXCTCGCTGCGCTCGGTCGTTCGGCT
GCGGCGGCGGTATCAGCTCACTCAAAGGCGGTAATACGGTTATCCACAGAATCAGGGGATAACXGCAGGAAAGAACATGTGAGCAAAAGG
CCAGCAAAAGGCCAGGAACCTAAAAAGGCCGCGTTGCTGGCGTTTTTCCATAGGCTCCGCCCCCCTGACGAGCATCACAAAAATCXGACG
CTCAAGTCAGAGGTGGCGAAACCCGACAGGACTATAAAGATACCAGGCGTTTCCCCCTGGAAGCTCCCTCGTGCCTCTCCTGTTCCGACC
CTGCCGCTTACCGGATACCTGTCCGCCTTTCTCCCTTCGGGAAGCGTGGCGCTTTCTCATAGCTCAGCTGTAGGTATCTCAATTCGGGGA
GGTCCTTCCCTCCCAGCTGGGCTGGGTGCACAAACCCCGGTTCAGCCCGACCGCTGGGCCCTTATCCGGTAA
Edits in Original Sequence 
TTTTTTTTTTTTTTTTTTTTTTTTCAGAGTAAAGCATGTATAACTTGCCCTTTTCGTTTCAGCATACATACAACAAGAGAATTTGGACAC
TTAACTTCTGCTGTTTAACAAGTTTATAACTTACTGACCCAGGACAACAGTCATGAAAGGTTAAACACAG
(5')ATGGTCATAGCTGTTT
CCTGTGTGAAATTGTTATCCgCTCACAATTCCACACAACATACGAGCCGGAAGCATAAAgTGTAAAGCCTGGGGTGCCTAATGAgTGAGC
TAACTCACATTAATTGCGTTGCGCTCACTGCCCGCTTTCCAGTCGGGAAACCTGTCGTGCCAGCTGCXATTAATGAATCGGCCAACGCXG
CGGGGAGAGGCGGTTTGCGTATTGGGCGCTCTTCCGCTTCCTCGCTCACTGAXCTCGCTGCGCTCGGTCGTTCGGCTGCGGCGaGCGGTA
TCAGCTCACTCAAAGGCGGTAATACGGTTATCCACAGAATCAGGGGATAACXGCAGGAAAGAACATGTGAGCAAAAGGCCAGCAAAAGGC
CAGGAACCgTAAAAAGGCCGCGTTGCTGGCGTTTTTCCATAGGCTCCGCCCCCCTGACGAGCATCACAAAAATCXGACGCTCAAGTCAGA
GGTGGCGAAACCCGACAGGACTATAAAGATACCAGGCGTTTCCCCCTGGAAGCTCCCTCGTGCgCTCTCCTGTTCCGACCCTGCCGCTTA
CCGGATACCTGTCCGCCTTTCTCCCTTCGGGAAGCGTGGCGCTTTCTCATAGCTCAcGCTGTAGGTATCTCAATTCGGGGtAGGTCCTTC
CCTCCCAGCTGGGCTGGGTGCACAAAcCCCCGGTTCAGCCCGACCGCTGGGCCCTTATCCGGTAA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan