ESTScan Details for Unigene SGN-U339662

Score 
-209
Direction 
Forward
Predicted Peptide Sequence 
MGLIHTPCSEGGPXYPIRPIVSRITIHWPSFYNVVTGKTLALPNXNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNILLKF
ALIFVKSAHFLTNRPKSAKSLINQKNRPEIGLSVVPVWNKSPLLKNVDSNVKGRKTVYQGDGPLREPSP
Predicted Coding Sequence 
ATGGGTTTGATTCACACTCCATGTTCTGAGGGGGGGCCCGXGTACCCAATTCGCCCTATAGTGAGTCGTATTACAATTCACTGGCCGTCG
TTTTACAACGTCGTGACTGGGAAAACCCTGGCGTTACCCAACTTXAATCGCCTTGCAGCACATCCCCCTTTCGCCAGCTGGCGTAATAGC
GAAGAGGCCCGCACCGATCGCCCTTCCCAACAGTTGCGCAGCCTGAATGGCGAATGGCAAATTGTAAGCGTTAATATTTTGTTAAAATTC
GCGTTAATTTTTGTTAAATCAGCTCATTTTTTAACCAATAGGCCGAAATCGGCAAAATCCCTTATAAATCAAAAGAATAGACCXGAGATA
GGGTTGAGTGTTGTTCCAGTTTGGAACAAGAGTCCACTATTAAAGAACGTGGACTCCAACGTCAAAGGGCGAAAAACCGTCTATCAGGGC
GATGGCCCACTACGTGAACCATCACCCTAA
Edits in Original Sequence 
GTAAAATCTCCCTTCCCAAATAAATAAGTTTGTTAATGAATCTCTTGATTTATTTGAAAAACAAGTAGGACACGTTTTCTCTAGTTTTTT
AGGGATCTACCAAGGAGTTCCATTACTGGCTCGTAGATTCGCTCATGACATTGTCATCTTGATACTATTGAAGTAGCTCATTTCAAATTC
AAACATGGGTTTGATTCACACTCCATGTTCTGAGGGGGGGCCC
(5')ATGGGTTTGATTCACACTCCATGTTCTGAGGGGGGGCCCGXGT
ACCCAATTCGCCCTATAGTGAGTCGTATTACAATTCACTGGCCGTCGTTTTACAACGTCGTGACTGGGAAAACCCTGGCGTTACCCAACT
TXAATCGCCTTGCAGCACATCCCCCTTTCGCCAGCTGGCGTAATAGCGAAGAGGCCCGCACCGATCGCCCTTCCCAACAGTTGCGCAGCC
TGAATGGCGAATGGCAAATTGTAAGCGTTAATATTTTGTTAAAATTCGCGTTaAATTTTTGTTAAATCAGCTCATTTTTTAACCAATAGG
CCGAAATCGGCAAAATCCCTTATAAATCAAAAGAATAGACCXGAGATAGGGTTGAGTGTTGTTCCAGTTTGGAACAAGAGTCCACTATTA
AAGAACGTGGACTCCAACGTCAAAGGGCGAAAAACCGTCTATCAGGGCGATGGCCCACTACGTGAACCATCACCCTAA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan