ESTScan Details for Unigene SGN-U339721

Score 
473
Direction 
Forward
Predicted Peptide Sequence 
MVNAFHKLEERMYGVLCNSEKSSTKAAVDAFAGMGVQVTVEDFGLSWAWGVEGFDAEAAKKRFFEIYLLKVIEISYIYEYXTLKADFTGQ
SFVVCRPNYGIGVPGAFELFSQVHPFLHSIYANTHTXALVCNVVXGGRSTFIKAKVYNSDENPGFDAIVSADALKSLKPAPDIFLAASRI
LDIPNMKLLTGVQAAKAAKMNCGGAESQSINDLLSNTKSNMMDFLELGFYPTSEAFHARSEKAWISLASLGAF
Predicted Coding Sequence 
ATGGTGAATGCGTTCCACAAATTGGAAGAGAGAATGTACGGTGTGCTTTGCAATAGTGAGAAATCATCAACAAAAGCGGCTGTGGATGCT
TTTGCTGGGATGGGTGTTCAAGTTACCGTTGAAGATTTTGGCCTTTCATGGGCATGGGGTGTTGAAGGATTTGATGCCGAGGCTGCAAAG
AAGAGGTTCTTTGAGATATATTTATTAAAGGTGATTGAAATTTCATATATTTACGAATATXCTACTCTCAAAGCAGATTTCACTGGGCAA
TCATTTGTAGTATGCAGACCGAATTATGGCATAGGTGTCCCTGGTGCCTTTGAACTTTTCTCTCAGGTCCATCCATTTCTTCACAGTATA
TATGCAAACACACACACTXATGCGTTGGTTTGTAATGTAGTTCXGGGAGGACGTAGTACTTTTATTAAGGCTAAAGTGTACAACTCGGAT
GAAAATCCAGGTTTTGATGCAATTGTATCTGCTGATGCCTTAAAAAGTTTGAAGCCTGCTCCTGATATTTTCTTGGCTGCATCACGGATT
CTTGATATTCCCAATATGAAATTATTAACTGGAGTACAAGCTGCCAAAGCTGCGAAAATGAATTGCGGTGGTGCAGAATCTCAATCCATT
AATGATCTGCTCTCTAACACTAAATCCAATATGATGGATTTTCTTGAGCTTGGATTTTATCCCACAAGTGAAGCCTTCCATGCTAGGTCA
GAAAAAGCTTGGATTTCACTGGCAAGTCTTGGTGCTTTT
Edits in Original Sequence 
CTTTAATGGTGAATGCGTTCCACAAATTGGAAGAGAGAATGTACGGTGTGCTTTGCAATAGTGAGAAATCATCAACAAAAGCGGCTGTGG
ATGCTTTTGCTG
(5')ATGGTGAATGCGTTCCACAAATTGGAAGAGAGAATGTACGGTGTGCTTTGCAATAGTGAGAAATCATCAACAAA
AGCGGCTGTGGATGCTTTTGCTGGGATGGGTGTTCAAGTTACCGTTGAAGATTTTGtGCCTTTCATGGGCATGGGGTGTTGAAGGATTTG
ATGCCGAGGCTGCAAAGAAGAGGTTCTTTGAGATATATTTATTAAAGGTGATTGAAATTTCATATATTTACGAATATXCTACTCTCAAAG
CAGATTTCACTGGGCAATCATTTGTAGTATGCAGACCGAATTATGGCATAGGTGTCCCTGGTGCCTTTGAACTTTTCTCTCAGGTCCATC
CATTTCTTCACAGTATATATGCAAACACACACACTXATGCGTTGGTTTGTAATGTAGTTCXGGGAGGACGTAGTACTTTTATTAAGGCTA
AAGTGTACAACTCGGATGAAAATCaCAGGTTTTGATGCAATTGTATCTGCTGATGCCTTAAAAAGTTTGAAGCCTGCTCCTGATATTTTC
TTGGCTGCATCACGGATTCTTGATATTCCCAATATGAAATTaATTAACTGGAGTACAAGCTGCCAAAGCTGCGAAAATGAATTGCGGTGG
TGCAgGAATCTCAATCCATTAATGATCTaGCTCTCTAACACTAAATCCAATATGATGGATTTTCTTaGAGCTTGGATTTTATCCCACAAG
TGAAGCCTTCCATGCTAGGTCAGAAAAAGCTTGGATTTCACTGGCAAGTCTTGGTGCTTTT(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan