ESTScan Details for Unigene SGN-U339739

Score 
186
Direction 
Forward
Predicted Peptide Sequence 
PAVAAALELVDPRAAGLSLLLGHLRLSSFNMSFEDHGKQTISVGPWGGENGLHWDDGVYSTIRKLEIAHGTGVDSIKVEYDKNGTSVISE
KHGGGGGAKTDKIILSYPDEFLISMNGYYGSLYERGSVFVRSLTFESNKRTYGPYGVEQGTYFTLPISRGKIVGFHGKCGWYLDAIGVYI
EPIHKSLPTHSVAQSQQLRSIGHSHQSIVQGMATYEYXNDTMKFGKXFDLIAARRHKEDHNKILPSSVLSRQSPSLSDTSSIEPLKRWHS
RPCPYRMSPSNWQGAVTYCHGV
Predicted Coding Sequence 
XXCCCCGCGGTGGCGGCCGCTCTAGAACTAGTGGATCCCCGGGCTGCAGGTCTAAGTCTCCTGCTCGGGCATCTTCGATTATCATCCTTC
AATATGAGTTTCGAGGATCATGGAAAACAGACCATTTCAGTCGGACCATGGGGAGGTGAAAATGGATTGCACTGGGATGATGGAGTTTAT
TCCACCATAAGGAAACTGGAAATAGCTCACGGAACAGGAGTTGATTCGATTAAGGTTGAGTACGACAAAAATGGAACCTCAGTAATCTCC
GAGAAGCATGGTGGTGGTGGAGGTGCTAAAACAGACAAGATAATACTTAGCTATCCAGATGAGTTTCTAATTTCTATGAACGGATATTAT
GGTAGCTTGTACGAAAGGGGGTCAGTTTTTGTTCGATCACTTACATTTGAAAGCAACAAAAGGACGTATGGACCATATGGTGTCGAGCAA
GGAACATATTTCACTCTACCAATCTCTAGGGGAAAAATTGTTGGCTTTCATGGAAAATGTGGCTGGTATCTTGATGCTATTGGAGTATAC
ATAGAGCCTATTCACAAGTCTTTGCCGACTCATTCTGTAGCTCAATCTCAGCAACTCCGTTCTATCGGTCATTCCCATCAAAGCATTGTC
CAAGGGATGGCAACTTATGAATACTXCAATGATACAATGAAGTTTGGTAAAAAXTTTGATCTCATTGCTGCACGTAGACACAAGGAGGAT
CACAACAAAATATTACCCTCGAGCGTACTTTCAAGACAAAGTCCTAGTCTATCCGATACTAGCTCTATCGAACCACTAAAAAGGTGGCAC
TCTAGGCCCTGCCCATATCGAATGAGTCCATCAAACTGGCAAGGTGCTGTGACATATTGTCATGGCGTG
Edits in Original Sequence 
(5')XXCCCCGCGGTGGCGGCCGCTCTAGAACTAGTGGATcCCCCGGGCTGCAGGTCTAAGTCTCCTGCTCGGGCATCTTCGATTATCAT
CCTTCAATATGAGTTTCGAGGATCATGGAAAACAGACCATTTCAGTCGGACCATGGGGAGGTGAAAATGGATTGCACTGGGATGATGGAG
TTTATTCCACCATAAGGAAACTGGAAATAGCTCACGGAACAGGAGTTGATTCGATTAAGGTTGAGTACGACAAAAATGGAACCTCAGTAA
TCTCCGAGAAGCATGGTGGTGGTGGAGGTGCTAAAACAGACAAGATAATACTTAGCTATCCAGATGAGTTTCTAATTTCTATGAACGGAT
ATTATGGTAGCTTGTACGAAAGGGGGTCAGTTTTTGTTCGATCACTTACATTTGAAAGCAACAAAAGGACGTATGGACCATATGGTGTCG
AGCAAGGAACATATTTCACTCTACCAATCTCTAGGGGAAAAATTGTTGGCTTTCATGGAAAATGTGGCTGGTATCTTGATGCTATTGGAG
TATACATAGAGCCTATTCACAAGTCTTTGCCGACTCATTCTGTAGCTCAATCTCAGCAACTCCGTTCTATCGGTCATTCCCATCAAAGCA
TTGTCCAAGGGATGGCAACTTATGAATACTXCAATGATACAATGAAGTTTaGGTAAAAAXTTTGATCTCATTGCTGCACGTAGACACAAG
GAGGATCACAACAAAATATTACCCTCGAGCGTACTTTCAAGACAAAGTCCTAGTCTgATCCGATACTAGCTCTATCGAACCACTAAAAAG
GTGGCACTCTAGGCCCTGCCCATATCGAATGAGTCCATCgAAACTGGCAAGGTGCTGTGACATATTGTCATGGCGTG(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan