ESTScan Details for Unigene SGN-U339747

Score 
-279
Direction 
Forward
Predicted Peptide Sequence 
MTGKTLALPNXNRLAAHPPFSSWINRKQARPDRPSQQLRNLIDNGKXVNLNXFVKIPVKFXVKSANFLTNRPKSVKSLINQKNRPEIGLT
VVPVWEHQSAIKERGLQRQKAKNLLSGQWPTTEPSPXCSXFRGPGAVKHLNRNPNGIPTFQLDGGSPLTWNX
Predicted Coding Sequence 
ATGACTGGGAAAACCCTGGCGTTACCCAACTTXAATCGCCTTGCGGCACATCCCCCTTTCTCCAGCTGGATTAATAGAAAACAGGCCCGC
CCCGATCGCCCTTCCCAACAGTTGCGAAACCTGATTGACAATGGCAAAXTTGTAAACCTTAATXATTTTGTTAAAATTCCCGTTAAATTT
XTTGTTAAATCAGCTAATTTTTTAACCAATAGGCCGAAATCGGTAAAATCCCTTATAAATCAAAAGAATAGACCXGAGATCGGGTTGACT
GTTGTTCCAGTTTGGGAACACCAGTCCGCTATTAAAGAACGTGGACTCCAACGGCAAAAGGCGAAAAACCTTCTATCAGGGCAATGGCCC
ACTACTGAACCATCCCCCTAATGCAGTTTXTTTAGGGGTCCAGGTGCCGTAAAGCACTTAAACCGGAACCCTAATGGTATCCCCACATTT
CAACTTGACGGGGGAAGCCCGCTTACGTGGAATGXX
Edits in Original Sequence 
TTGTTGTTGTTCAATAAACAGTACAGTCTAACCAAACATTGTATCTATCACATAGTATTGTACAATAGAATACAAATAGAGTACAATGAC
AGTACATTATGAAATAATGGATAACAATGTTTGGTTAGACTGTACTGGTTGTTGTTGTTCAATAAATTTTTTATGTGTTTGGTTTGACCG
AACAAAAATAAAATCAACTTGAAAAAAATAACACATTAACCTCGAGGGGGGGCCCGGTACCA
(5')ATGACTGGGAAAACCCTGGCGTTA
CCCAACTTXAATCGCCTTGCGGCACATCCCCCTTTCTCCAGCTGGATTAATAGAAAACAGGCCCGCCCCGATCGCCCTTCCCAACAGTTG
CGAAACCTGATTGACtAATGGCAAAXTTGTAAACCTTAATXATTTTGTTAAAATTCCCGTTAAATTTXTTGTTAAATCAGCTAATTTTTT
AACCAATAGGCCGAAATCGGTAAAATCCCTTATAAATCAAAAGAATAGACCXGAGATCGGGTTGACTGTTGTTCCAGTTTGGGAACACCA
GTCCGCTATTAAAGAACGTGGACTCCAACGGCAAAAGGCGAAAAACCTTCTATCAGGGCAATGGCCCACTACgTGAACCATCCCCCTAAT
GCAGTTTXTTTAGGGGTCCAGGTGCCGTAAAGCACTTAAACCGGAACCCTAATGGTATCCCCACATTTCAACTTGACGGGGGAAGCCCGC
TTACGTGGAATGXX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan