ESTScan Details for Unigene SGN-U339769

Score 
220
Direction 
Forward
Predicted Peptide Sequence 
VAAAIEPKDPXGLQELGTRVXMFEIIVPTKEKIGGCFRYGNPKSRYIDVTVALNAALEQXDDSKVKQAGVELYLGRNERIWKCENPLGGN
PNQYHNATWNVIEKFLCSTVGRSAIATSECRYEAALILRNACLKDLTLGEVL
Predicted Coding Sequence 
XGGGTGGCTGCCGCAATTGAGCCAAAGGACCCCXCCGGGCTGCAGGAATTGGGCACTAGGGTTTTXATGTTTGAGATTATTGTGCCTACC
AAAGAAAAGATCGGTGGGTGTTTTCGTTATGGTAACCCTAAATCTCGTTATATTGATGTCACAGTAGCATTAAATGCTGCACTAGAGCAA
CAXGATGATAGTAAAGTGAAACAAGCTGGTGTTGAACTATATCTTGGTAGAAATGAGAGGATTTGGAAATGTGAGAATCCACTTGGTGGC
AATCCTAACCAATATCACAATGCAACTTGGAACGTGATTGAGAAATTTCTTTGTTCAACTGTTGGACGTTCAGCAATAGCAACATCTGAA
TGCAGGTATGAAGCTGCTTTGATTCTTAGAAATGCATGCCTTAAAGACCTTACATTGGGTGAAGTTCTTTAA
Edits in Original Sequence 
(5')XGGGTGGCTGCCGCAATTGAGCCAAAGGACCCCXCCGGGCTGCAGGAATTGGGCACTAGGGTTTTXATGTTTGAGATTATTGTGCC
TACCAAAGAAAAGATCGGTGGGTGTTTTCGTTATGGTAACCCTAAATCTCGTTATATTGATGTCACAGTAGCATTAAATGCTGCACTAGA
GCAACAXGATGATAGTAAAGTGaAAACAAGCTGGTGTTGAACTATATCTTGGTAGAAATGAGAGGATTTGGAAATGTGAGAATCCACTTG
GTGGCAATCCTAACCAATATCACAATGCAACTTGGAACGTGATTGAGAAATTTCTTTGTTCAACTGTTGGACGTTCAGCAATAGCAACAT
CTGAATGCAGGTATGAAGCTGCTTTGATTCTTAGAAATGCATGCCTTAAAGACCTTACATTGGGTGAAGTTCTTTAA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan