ESTScan Details for Unigene SGN-U339814

Score 
66
Direction 
Reverse
Predicted Peptide Sequence 
MFTQLKGRVLQGNADNTAMGSDPEIVYVRGHNRTLIANESQEAQTSXAGETAKLKLEMCKNLLMNSLKDDYNKRTSKLCINLALAAYKKC
PNYXPDISDIVKDFEKVRW
Predicted Coding Sequence 
ATGTTTACACAATTAAAGGGCAGGGTACTTCAAGGAAATGCTGATAACACAGCTATGGGATCTGACCCTGAGATAGTTTACGTAAGAGGA
CATAACAGGACATTAATAGCCAATGAATCTCAAGAAGCACAAACTAGTAXAGCTGGTGAAACAGCTAAGCTCAAGCTGGAAATGTGTAAA
AACTTGTTGATGAATAGCCTTAAAGATGACTACAACAAAAGAACAAGCAAGCTATGCATTAACTTAGCACTTGCTGCTTACAAAAAATGC
CCAAATTACGAXCCTGACATTAGTGACATTGTTAAAGATTTTGAAAAGGTGAGATGG
Edits in Original Sequence 
CAAAAAATGCCCAAATTACGACCTGACATTAGTGACATTGTTAAAGATTTTGAAAAGGTGAGATGGAGTTACCATCCCTCCCTTTCGAAT
TCTCTCCCTCTCCACCTTCGAGAACGTTCAGCAGATCAAAAAGACGACATAAGAGTTACGCAGAATAGGAATTACTTGTCCATGTTGAGA
AATTTTCTCCGAATGTATTTGTAGAATCACTTGTTTTTTCAATGTAAATATGATGAATGCACTAAATTTTATCTTATTTGATGATT
(5')
ATGTTTACACAATTAAAGcGGCAGGGTACTTCAAGGAAATGCTGATAACACAGCTATGGGATCTGACCCTGAGATAGTTTACGTAAGAGG
ACATAACAGGACATTAATAGaCCAATGAATCTCAAGAAGCACAAACTAGTAXAGCTGGTGtAAACAGCTAAGCTCAAGCTGGAAATGTGT
AAAAACTTGTTGATGAATAGCCTTAAAGATGACTACAACAAAAGAACAAGCAAGtCTATGCATTAACTTAGCACTTGCaTGCTTACAAAA
AATGCCCAAATTACGAXCCTGACATTAGTGACATTGTTAAAGATTTTGAAAAGGTGAGATGG(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan