ESTScan Details for Unigene SGN-U339864

Score 
-80
Direction 
Forward
Predicted Peptide Sequence 
MQEGSDFLAELRWIDPRAEFFGSTSVDLQARELQLLFPLVRANFELGVIKVMAVSCVKLVFGHNSTQYTSGSIKGKALGXLMSEVTTELG
LRFEVTNQFFILTSRNPYRPFVKGWGVPNLEARFWGTPIPGPNGGPWEAVENPXATLFPPNPSLDRCLTITPMEP
Predicted Coding Sequence 
ATGCAAGAAGGGAGTGATTTCTTGGCXGAACTCAGGTGGATTGATCCTCGTGCCGAATTCTTTGGATCCACTAGTGTCGACCTGCAGGCG
CGCGAGCTCCAGCTTTTGTTCCCTTTAGTGAGGGCTAATTTCGAGCTTGGCGTAATCAAGGTCATGGCTGTTTCCTGTGTGAAATTGGTA
TTCGGTCACAATTCCACACAATATACGAGCGGGAGTATTAAGGGGAAAGCCTTAGGCXGCCTAATGAGTGAGGTTACTACAGAATTGGGG
TTGCGGTTTGAGGTTACTAACCAGTTTTTTATATTGACTTCAAGGAACCCCTACCGCCCATTTGTCAAGGGGTGGGGTGTTCCCAATTTG
GAGGCCCGTTTTTGGGGCACACCAATTCCTGGCCCAAATGGGGGGCCCTGGGAGGCGGTTGAAAACCCTXTTGCAACCCTTTTCCCCCCA
AACCCTTCCCTGGATAGATGCCTAACTATTACTCCCATGGAACCCTAG
Edits in Original Sequence 
AAACTTCTAACAAGATAATAATATAATACCATGACAAGGTGATAGGCCCAAAAGTAACAAAATACAATATTTTTAAAAATAAATTTGGAC
TCTCTAGCCCAATATCTTAAACTTCTCGGTCTGTACATCGATTTCTTTCACTTCTTGACACGTATGCATTTTCTGATTGAGTGAGTCAAA
AAGCATTTTGTGTCTTTATGACTCTTCTCGAAATGCAAGAAGGGAGTGATTTCTTGGCGAACTCAGGTGGATTGATC
(5')ATGCAAGAA
GGGAGTGATTTCTTGGCXGAACTCAGGTGGATTGATCCTCGTGCCGAATTCTTTGGATCCACTAGTGTCGACCTGCAGGCGCGCGAGCTC
CAGCTTTTGTTCCCTTTAGTGAGGGCTAATTTCGAGCTTGGCGTAATCAAGGTCATGGCTGTTTCCTGTGTGAAATTGGTATTCGGTCAC
AATTCCACACAATATACGAGCGGGAGTATTAAGGGGAAAGCCTTAGGCXGCCTAATGAGTGAGGTTACTACAGAATTGGGGTTGCGGTTT
GAcGGTTACTAACCAGTTTTTTATATTGACTTCAAcGGAACCCCTACCGCCCATTTGTCAAGGGGTGGGGTGTTCCCAATTTGGAGGCCC
GTTTTTGGGGCACACCAATTCCTGGCCCAAATGGGGGGCCCTGGGAGGCGGTTGAAAACCCTXTTGCAACCCTTTTCCCCCCAAACCCTT
CCCTGGATAGATGCCTAACTATTACTCCCATGGAACCCTAG(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan