ESTScan Details for Unigene SGN-U339872

Score 
-461
Direction 
Reverse
Predicted Peptide Sequence 
RTGNTASALGAVLSLLPFLSRHVRRLSPSSFKSGAPLGFRFSALRQLDLKELDWVMVHVVGHRPDRRFFPFDVGATFCNSGXLVPNWNNT
STLSRSILLIYKDFADLAYWLKNELINKNLTRILQNINAYNLPFAIQAAQLLGRAIGAGLFAITPAGERGMCCKAIKLGNARVFPVTTL
Predicted Coding Sequence 
XTGCGTACCGGTAACACTGCCAGCGCCCTAGGGGCCGTCCTTTCGCTTCTTCCCTTCCTTTCTCGCCACGTTCGCCGGCTTTCGCCGTCA
AGCTTTAAATCGGGGGCTCCCTTAGGGTTCCGATTTAGTGCTTTACGGCAACTCGACCTCAAAGAACTTGATTGGGTGATGGTTCACGTA
GTGGGCCATCGCCCCGATAGACGGTTTTTCCCCTTTGACGTTGGAGCCACGTTCTGTAATAGTGGAXCTCTTGTTCCAAACTGGAACAAC
ACGTCAACCCTATCTCGGTCTATTCTTTTGATTTATAAGGATTTTGCCGATTTGGCCTATTGGTTAAAAAATGAGCTGATTAACAAAAAT
TTAACGCGAATTTTACAAAATATTAACGCTTACAATTTGCCATTCGCCATTCAGGCTGCGCAACTGTTGGGAAGGGCGATCGGTGCGGGC
CTCTTCGCTATTACGCCAGCTGGCGAAAGGGGGATGTGCTGCAAGGCGATTAAGTTGGGTAACGCCAGGGTTTTCCCAGTCACGACGTTG
TAA
Edits in Original Sequence 
(5')XTGCGTACCGGTAACACTGCCAGCGCCCTAGGGGCCGTCCTTTCGCTTCTTCCCTTCCTTTCTCGCCACGTTCGCCGGCTTTCGCC
GTCAAGCTTTAAATCGGGGGCTCCCTTAGGGTTCCGATTTAGTGCTTTACGGCAACTCGACCTCAAAGAACTTGATTaGGGTGATGGTTC
ACGTAGTGGGCCATCGCCCCGATAGACGGTTTTTCgCCCTTTGACGTTGGAGtCCACGTTCTGTAATAGTGGAXCTCTTGTTCCAAACTG
GAACAACACGTCAACCCTATCTCGGTCTATTCTTTTGATTTATAAgGGATTTTGCCGATTTcGGCCTATTGGTTAAAAAATGAGCTGAtT
TAACAAAAATTTAACGCGAATTTTaACAAAATATTAACGCTTACAATTTGCCATTCGCCATTCAGGCTGCGCAACTGTTGGGAAGGGCGA
TCGGTGCGGGCCTCTTCGCTATTACGCCAGCTGGCGAAAGGGGGATGTGCTGCAAGGCGATTAAGTTGGGTAACGCCAGGGTTTTCCCAG
TCACGACGTTGTAA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan