Notice: Due to a regional power outage, SGN was briefly unavailable on Saturday, Feb 4. We apologize for the inconvenience.

ESTScan Details for Unigene SGN-U339936

Score 
204
Direction 
Forward
Predicted Peptide Sequence 
MPLYKDEPPAVRVYTVCDESKYLIVRNVPALGCGDQLSQLFSTYRKIEECKPMDDEDCEPFTDSSGSSFAGLTMPVKYLIKLLWDTARLC
IAKGLQYPYNXNRIFVKELVQHSIIXLDDDLQKEAGLICFPKKKAQVSYAPQFDSLHETKEKLEARRQEVLARLNPGRSKRSATYRPDMI
GEPSISSSAAQLNSTAQSIGSNHMQISSSPGNSVHEMQCSHMTMRSSDXAYFASQTMNQTVKLVIDHYLRYNPV
Predicted Coding Sequence 
ATGCCTCTATACAAAGACGAGCCTCCTGCAGTCCGTGTTTACACTGTTTGCGATGAATCCAAATATTTGATTGTGAGGAATGTTCCGGCG
TTGGGTTGTGGTGATCAGCTCTCTCAACTATTCTCCACTTACAGAAAAATTGAAGAATGTAAACCAATGGATGATGAAGATTGTGAGCCA
TTTACAGATTCTTCTGGATCAAGTTTTGCCGGGTTGACAATGCCAGTGAAATATCTCATTAAACTGCTATGGGATACGGCAAGATTGTGT
ATTGCAAAAGGACTCCAATACCCTTATAACAXCAATAGAATTTTTGTGAAGGAACTGGTCCAGCATAGCATTATTXTTCTGGACGATGAT
TTGCAAAAAGAAGCTGGACTAATCTGTTTTCCTAAGAAAAAAGCTCAGGTCTCTTATGCACCTCAATTTGATAGTCTGCACGAGACGAAG
GAGAAGTTAGAAGCGAGGAGACAGGAAGTTCTAGCACGATTAAACCCTGGAAGGTCTAAACGATCTGCCACATATCGGCCAGATATGATT
GGTGAGCCCTCGATATCTTCCTCTGCAGCCCAGTTGAATTCTACCGCACAATCAATTGGCTCTAATCATATGCAGATCTCGAGTTCTCCG
GGTAATTCTGTTCATGAGATGCAGTGTTCTCACATGACAATGCGTTCTTCAGACNACGCATACTTTGCTTCACAGACTATGAATCAGACT
GTTAAGCTGGTCATAGATCACTACCTTAGATACAATCCAGTX
Edits in Original Sequence 
GCAAAGGTTGAGTTTCATGTGAAATTGTGCAATGCCTCTATACAAAGACGAGCCTCCTGCAGTCCGTGTTTACACTGTTTGCGATGAATC
CAAATATTTGATTGTG
(5')ATGCCTCTATACAAAGACGAGCCTCCTGCAGTCCGTGTTTACACTGTTTGCGATGAATCCAAATATTTGA
TTGTGAGGAATGTTCCGGCGTTGGGTTGTGGTGATCAGCTCTCTCAACTATTCTCCACTTACAGAAAAATTGAAGAATGTAAACCAATGG
ATGATGAAGATTGTGAGCCATTTACAGATgTCTTCTGGATCAAGTTTTGCCGGGTTGACAATGCCAGTGAAATATCTCATTAAACTGCTA
TGGGATACGGCAAGATTGTGTATTGCAAAAGGACTCCAATACCCTTATAACAXCAATAGAATTTTTGTGAAGGAACTGGTCCAGCATAGC
ATTATTXTTCTGGACGATGATTTGCtAAAAAGAAGCTGGACTAATCTGTTTTCCTAAGAAAAAAGCTaCAGGTCTCTTATGCACCTCAAT
TTGATAGTCTGCACGAGACGAAGGAGAAGTTAGAAGCGAGGAGACAGGAAGTTCTAGCACGATTAAACCCTGGAAGGTCTAAACGATCTG
CCACATATCGGCCAGATATGATTGGTGAGCCCTCGATATCTTCCTCTGCAGCCCAGTTGAATTCTACCGCACAATCAATTGGCTCTAATC
ATATGCAGATCTCGAGTTCTCCGGGTAATTCTGTTCATGAGATGCAGTGTTCTCACATGACAATGCGTTCTTCAGACNACGCATACTTTG
CTTCACAGACTATGAATCAGACTGTTAAGCTGGTCATAGATaCACTACCTTAGATACAATCCAGTX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan