ESTScan Details for Unigene SGN-U339964

Score 
559
Direction 
Forward
Predicted Peptide Sequence 
GKEGGFXFSYSXRAPLLGGRSRTSGSPGLQEFGTRCRLLLRAQVVKYLPICRMGKGKKKARVPVENFEEDADSDDVEMNGNEENMNGSSS
SEKSLYEILGVETTASQQEIKKAYYKLALRLHPDKNPDDEEAKEKFQQLQKVISILGDEEKRALYDQTGSVDDADLAGDVVDNLKEFFRA
MHPKITEADIDKFEASYRGSXVGEDKIDCSIPEV
Predicted Coding Sequence 
GGNAAGGAGGGGGGTTTTANTTTCAGCTATTCANGTAGAGCCCCCCTATTGGGCGGTCGCTCTAGAACTAGTGGATCCCCCGGGCTGCAG
GAATTCGGCACGAGGTGTCGATTGCTTTTGCGTGCTCAAGTAGTGAAGTATCTTCCGATTTGTCGTATGGGAAAGGGAAAGAAGAAGGCT
AGGGTTCCGGTGGAGAATTTTGAAGAAGACGCCGATTCCGATGACGTTGAAATGAATGGAAATGAAGAGAATATGAACGGATCTTCTTCT
AGCGAAAAGAGTCTTTATGAGATTCTTGGGGTTGAAACAACAGCATCCCAGCAGGAAATAAAGAAGGCATATTACAAGCTGGCTCTGCGT
CTTCATCCTGATAAGAATCCTGATGATGAGGAAGCAAAAGAGAAATTTCAGCAGTTGCAAAAGGTGATATCAATTCTTGGAGATGAGGAG
AAACGAGCTCTTTATGATCAGACTGGCAGTGTTGATGATGCTGACTTGGCAGGAGATGTCGTTGATAACTTGAAGGAGTTTTTCCGAGCT
ATGCATCCAAAGATAACCGAGGCGGATATTGACAAGTTTGAAGCTAGTTATAGAGGATCTGAXGTCGGAGAGGACAAAATTGATTGTTCT
ATTCCAGAAGTTTAA
Edits in Original Sequence 
(5')GGNAAGGAGGGGGGTTTTANTTTCAGCTATTCANGTAGAGCCCCCCTATTGGGCGGTCGCTCTAGAACTAGTGGATCCCCCGGGCT
GCAGGAATTCGGCACGAGGTGTCGATTGCTTTTGCGTGCTCAAGTAGTGtAAGTATCTTCCGATTTGTCGTATGGGAAAGGGAAAGAAGA
AGGCTAGGGTTCCGGTGGAGAATTTTGAAGAAGACGCCGATTCCGATGACGTTGAAATGAATGGAAATGAAGAGAATATGAACGGATCTT
CTTCTAGCGAAAAGAGTCTTTATGAGATTCTTGGGGTTGAAACAACAGCATCCCAGCAGGAAATAAAGAAGGCATATTACAAGCTGGCTC
TGCGTCTTCATCCTGATAAGAATCCTGATGATGAGGAAGCAAAAGAGAAATTTCAGCAGTTGCAAAAGGTGATATCAATTCTTGGAGATG
AGGAGAAACGAGCTCTTTATGATCAGACTGGCAGTGTTGATGATGCTGACTTGGCAGGAGATGTCGTTGATAACTTGAAGGAGTTTTTCC
GAGCTATGCATCCAAAGATAACCGAGGCGGATATTGACAAGTTTGAAGCTAGTTATAGAGGATCTGAXGTCGGAGAGGACAAAATTGATT
GTTCTATTCCAGAAGTTTAA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan