ESTScan Details for Unigene SGN-U340129

Score 
244
Direction 
Reverse
Predicted Peptide Sequence 
IYVXGPKLKGKNLSDNEFYKLLTLADLDSSVFNKSGGILSVGQAQRVALARTLVNEPEVLLLDEPTSALDPISTQNIEDVLVKLKKDQKM
TIVIVSHSIKQIQRIADIVCLLVDGDIVEIIKPDQLSEGKHPMAQDFFNSAPSVILGKSRTRDKESTSRHELAEKHDNGXAREIQVTKIW
KNLNPFDEPILTEVNLATETTVEKYTLIKKVFYLPRQSFRWRNQEKRGKFL
Predicted Coding Sequence 
ATATACGTTAXGGGGCCAAAACTCAAGGGAAAGAACCTAAGTGATAATGAGTTTTACAAGTTGCTGACTTTGGCTGATCTAGACTCATCT
GTCTTCAACAAGTCAGGTGGGATACTATCTGTTGGCCAAGCACAGAGAGTTGCACTTGCCAGAACGTTAGTTAATGAACCAGAGGTTCTG
CTATTGGATGAGCCAACTAGTGCATTAGATCCAATATCAACACAGAATATCGAGGACGTTCTAGTAAAGCTCAAGAAGGATCAGAAGATG
ACAATTGTGATAGTTTCTCATAGCATCAAGCAAATACAGAGAATAGCTGATATAGTGTGCCTGCTGGTTGATGGGGACATTGTGGAAATT
ATAAAGCCTGATCAACTCTCTGAAGGTAAGCATCCCATGGCACAAGATTTCTTCAACTCAGCTCCTAGTGTXATTTTAGGCAAAAGTAGA
ACCAGGGACAAGGAAAGTACATCAAGGCACGAACTAGCGGAGAAGCATGATAATGGTXTAGCAAGAGAGATTCAAGTCACCAAAATATGG
AAGAATCTCAACCCATTCGATGAGCCAATCTTAACTGAGGTTAATTTAGCTACTGAAACTACTGTAGAAAAATACACTTTAATAAAAAAG
GTATTTTACCTCCCACGACAATCTTTCCGATGGCGCAACCAAGAAAAACGGGGCAAATTCTTGTAA
Edits in Original Sequence 
(5')ATATACGTTAXGGGGCCAAAACTCAAGGGAAAGAACCTAAGTGATAATGAGTTTTACAAGTTGCTGACTTTGGCTGATCTAGACTC
ATCTGTCTTCAACAAGTCAGGTGGGATACTATCTGTTGGCCAAGCACAGAGAGTTGCACTTGCCAGAACGTTAGTTAATGAACCAGAGGT
TCTGCTATTGGATGAGCCAACTAGTGCATTAGATCCAATATCAACACAGAATATCGAGGACGTTCTAGTAAAGCTCAAGAAGGATCAGAA
GATGACAATTGTGATAGTTTCTCATAGCATCAAGCAAATACAGAGAATAGCTGATATAGTGTGCCTGCTGGTTGATGGGGACATTGTGGA
AATTATAAAGCCTGATCAACTCTCTGAAGGTAAGCATCCCATGGCACtAAGATTTCTTCAACTCAGCTCCTAGTGTXATTTTAGGCgAAA
AGTAGAACCAGGGACAAGGAAAGTACATCAAGGCACGAACTAGCGGAGAAGCATGATAATGGTXTAGCAAGAGAGATTCAAGTCACCAAA
ATATGGAAGAATCTCAACCCATTCGAgTGAGCCAATCTTAACTGAGGTTAATTTAGCTACTGAAACTACgTGTAGAAAAATACACTTTAA
TAAAAAAGGTATTTTACCTCCCACGACAATCTTTCCGATGGCGCAACCAAGAAAAACGGGGCAAATTCTTGTAA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan