ESTScan Details for Unigene SGN-U340206

Score 
222
Direction 
Forward
Predicted Peptide Sequence 
GCMMXXGSXYDXNXLAACIATLADPKNSARAHMSLXLYLDDFVRLKAGMQNVIQPGLLKEGFCAVQDESAGLVVSIVDPQPGENIIDCCA
APGGKTLFMASRLNGQGKLLAVDINEGRLXDTQRDSQAAPSY
Predicted Coding Sequence 
GGATGTATGATGGNAGNTGGATCCGNCTACGATNACAATGNACTAGCTGCCTGCATTGCGACACTAGCCGATCCAAAGAATTCGGCACGA
GCCCACATGAGCCTTCXTCTATACTTGGATGATTTTGTTCGTCTAAAGGCTGGAATGCAGAATGTTATACAGCCCGGGTTACTAAAAGAA
GGCTTCTGTGCAGTCCAGGATGAAAGTGCCGGATTAGTAGTCTCTATTGTTGATCCACAGCCTGGTGAGAACATAATTGATTGTTGTGCT
GCTCCAGGAGGGAAAACCTTGTTCATGGCATCCCGTTTGAATGGCCAAGGTAAATTATTAGCTGTTGACATAAATGAAGGTCGATTGCXG
GATACTCAGAGAGACAGCCAAGCTGCACCAAGTTATTGA
Edits in Original Sequence 
(5')GGATGTATGATGGNAGNTGGATCCGNCTACGATNACAATGNACTAGCTGCCTGCATTGCGACACTAGCCGATCCAAAGAATTCGGC
ACGAGCCCACATGAGCCTTCXTCTATACTTGGATGATTTTGTTCGTCTAAAGGCTGGAATGCAGAATGTTATACAGCCCGGGTTACTAAA
AGAAGGCTTCTGTGCAGTCCAGGATGAAAGTGCCGGATTAGTAGTCTCTATTGTTGATCCACAGCCTGGTGAGAACATAATTGATTGTTG
TGCTGCTCCAGGAGGGAAAACCTTGTTCATGGCATCCCGTTTGAATGGCCAAGGTAAATTATTAGCTGTTGACATAAATGAAGGTCGATT
GCXGGATACTCAGAGAGACAGCCAAGCTGCACCAAGTTATTGA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan