ESTScan Details for Unigene SGN-U340275

Score 
364
Direction 
Forward
Predicted Peptide Sequence 
MEKVKKVSLFQSSSLLRQQKDAKIALQLFLNPNPSHGSDKTTKPFRYSPLCYDLIICKLGRGKLFQEMEKIIDKLRQDTRVSLNEVVFCN
VISFYGRAHLPDKALHMFNEIPSFAAIEXIKSVNSLLNALLACKEYSKIGEMLNNFENYATPDVCTFNILMNAVVCVVIWGGAREVFDEM
CERRIQPNVVTLGTLINGLLVNREINEAFRMKKIWERDXKXKPNLFVLVALIKGLGRVDDLDPAV
Predicted Coding Sequence 
ATGGAGAAAGTGAAAAAGGTATCACTCTTTCAGTCTTCTTCTCTACTTCGCCAGCAAAAAGATGCTAAAATCGCCCTTCAACTCTTCCTT
AATCCTAATCCCAGCCATGGAAGCGACAAAACTACTAAACCTTTTCGTTATTCTCCACTCTGTTATGATCTCATCATCTGCAAGCTCGGC
AGAGGTAAACTCTTTCAAGAAATGGAAAAAATCATCGATAAATTGAGACAGGACACTCGAGTTTCTCTCAACGAAGTTGTTTTCTGCAAT
GTTATTTCTTTTTATGGAAGAGCACATTTACCTGATAAGGCTCTTCATATGTTTAATGAAATACCCTCTTTTGCTGCTATAGAAGXTATA
AAATCTGTTAATAGCTTGTTGAATGCACTTTTAGCTTGTAAAGAATACAGCAAGATTGGTGAAATGTTAAACAACTTTGAAAATTACGCA
ACCCCAGATGTTTGTACGTTTAATATATTGATGAATGCTGTTGTTTGTGTGGTGATTTGGGGTGGTGCACGGGAGGTGTTTGATGAAATG
TGTGAGAGAAGAATTCAGCCAAATGTGGTGACTTTGGGGACGTTGATTAATGGGCTTTTGGTGAATCGAGAAATTAACGAGGCGTTTAGG
ATGAAAAAGATATGGGAGAGAGATTNTAAGXTGAAGCCTAATCTTTTCGTGTTGGTCGCGTTGATTAAAGGACTTGGAAGGGTTGATGAT
TTGGATCCGGCAGTTTAG
Edits in Original Sequence 
GGTTCCTTTGAACAATTTAGGAATGCCGAAAATGGAGAAAGTGAAAAAGGTATCACTCTTTCAGTCTCTCTTCTCTACTTCGCCAGCAAA
AAGATGCTAAAATCGCCCTT
(5')ATGGAGAAAGTGAAAAAGGTATCACTCTTTCAGTCTcTCTTCTCTACTTCGCCAGCAAAAAGATGC
TAAAATCGCCCTTCAACTCTTCCTTAATCCTAATCCCAGCCATGGAAGCGACAAAACTACTAAACCTTTTCGTTATTCTCCACTCTGTTA
TGATCTCATCATCTGCAAGCTCGGCAGAGGTAAACTCTTTCAAGAAATGGAAAAAATCATCGATAAATTGAGACAGGACACTCGAGTTTC
TCTCAACGAAGTTGTTTTCTGCAATGTTATTTCTTTTTATGGAAGAGCACATTTACCTGATAAGGCTCTTCATATGTTTAATGAAATACC
CTCTTTTcGCTGCTATAGAAGXTATAAAATCTGTTAATAGCTTGTTGAATGCACTTTTAGCTTGTAAAGAATACAGCAAGATTGGTGAAA
TGTTAAACAACTTTGAAAATTACGCAACCCCAGATGTTTGTACGTTTAATATATTGATGAATGCgTGTTGTTTGTGTGGTGATTTGGGGT
GGTGCACGGGAGGTGTTTGATGAAATGTGTGAGAGAAGAATTCAGCCAAATGTGGTGACTTTGGGGACGTTGATTAATGGGCTTTTGtGT
GAATCGAGAAATTAACGAGGCGTTTAGGATGAAAAAGATATGGGAGAGAGATTNTAAGXTGAAGCCTAATCTTTTCGTGTTGGTCGCGTT
GATTAAAGGACTTGGAAGGGTTGATGATTTGGATCCGGCAGTTTAG(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan