ESTScan Details for Unigene SGN-U340324

Score 
184
Direction 
Forward
Predicted Peptide Sequence 
MAGAASALFLLDIKGRVLVWRDFRGDVSSVQAERFFTKLLEKEGDPQDPXAYDNGVTYMFIQHNNVYLMTASRQKCNAASISLFLHRVGD
VF
Predicted Coding Sequence 
ATGGCAGGGGCGGCATCGGCGCTGTTCCTACTTGACATCAAAGGCAGAGTACTGGTTTGGCGTGATTTCCGTGGAGATGTCTCGTCCGTC
CAGGCCGAACGATTCTTCACCAAGCTCCTTGAGAAAGAGGGTGACCCTCAAGATCCTGXTGCATATGATAATGGCGTGACATATATGTTT
ATACAGCACAATAATGTATACCTCATGACCGCATCAAGGCAGAAATGTAATGCTGCTAGTATTTCTCTGTTTCTACACCGTGTTGGTGAC
GTCTTTTAA
Edits in Original Sequence 
GAACAATACCCTAAGAGAGGAAAAAAGAAGAGAGAGAAGAGAGGAAGAAAGATGAAAAGATTTTTTCTTTTAAATGATTTGGTTTGAATT
ATAAGATTTTTTTTTTTTGTATTTTATAAAACATTAAATTTTTTCAAGATATTAATTTGATCCTATAATTAATTAATTACATTTTAAAGA
AAATTTAACTTCTTTCATCAATCTGTCATCAAAAACAAAAACACACTTATTTGACACATTTCCCTTAATTTTCTCAAATGAGTTCACTTA
CAATGAATCAATAATGTGAAAAATTGAGTTAGCTGATTGGAAATCCATCTGAAACTATAGTTCAATCCTAACAAATTCCAAAATCAATTC
TCAATCACCTCCAGATCTCATCGGAGATCGCTATATTCGCCGCGAATTCTGATTTGAGATTGTTATATCACATGGCAGGGGCGGCATCGG
CGCTGTTCCTACTTGACATC
(5')ATGGCAGGGGCGGCATCGGCGCTGTTCCTACTTGACATCAAAGGCAGAGTACTGGTTTGGCGTGAT
TTCCGTGGAGATGTCTCGTCCGTCCAGGCCGAACGATTCTTCACCAAGCTCCTTGAGAAAGAGGGTGACCCTCAAGATCCTGXTGCATAT
GATAATGGCGTGACATATATGTTTATACAGCACAATAATGTATACCTCATGACCGCATCAAGGCAGAAATGTAATGCTGCTAGTATTTCT
CTGTTTCTACACCGTGTTGGTGACGTCTTTTAA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan