ESTScan Details for Unigene SGN-U340328

Score 
333
Direction 
Forward
Predicted Peptide Sequence 
MPSAATMFQVYASISTAITMFXNNDPPVGPSASSVLIETKIRRYFRPNSSDVTLVIEERDGMGINDVFTCAEIYLSARISPEFQRFKITK
RPKDTGVNVKFGNCGKITDSFEEIELVWKFVNEAKKSISRFQDDDEGDFSEKHTFELSFSKQHKERILNTYILFVLNTAKTMRYEKKIIQ
LHSLIGNCYSSYKMGICEP
Predicted Coding Sequence 
ATGCCTTCAGCGGCTACAATGTTCCAGGTGTATGCCTCAATATCTACTGCCATTACAATGTTTAAXAACAATGATCCACCAGTTGGTCCC
TCAGCAAGTTCAGTGCTTATTGAAACCAAAATTCGTAGATATTTTCGCCCAAATTCGTCAGATGTGACTTTGGTTATCGAAGAAAGAGAT
GGCATGGGCATCAACGATGTCTTCACTTGTGCTGAAATCTATTTGTCTGCACGAATCAGCCCAGAATTTCAACGTTTCAAAATTACCAAA
CGACCCAAAGACACAGGGGTCAATGTTAAATTTGGGAATTGTGGGAAAATTACTGATTCTTTTGAAGAGATTGAATTGGTATGGAAGTTT
GTTAATGAAGCGAAGAAGTCGATTTCGAGATTTCAAGATGATGATGAAGGTGATTTTTCTGAGAAACATACGTTTGAGCTGAGCTTTAGC
AAACAACACAAGGAAAGGATTCTGAATACCTACATCCTCTTTGTACTTAACACGGCCAAAACGATGCGGTACGAGAAAAAAATTATTCAA
TTGCATTCTCTTATTGGTAACTGTTATAGCTCCTATAAAATGGGAATCTGTGAACCTTGA
Edits in Original Sequence 
GTTTGTTGATATGATGAGTCTCTCAAGTATGCCTTCAGCGGCTACAATGTTCCAGGTGTATGCCTCAATATCTACTGCC(5')ATGCCTT
CAGCGGCTACAATGTTCCAGGTGTATGCCTCAATATCTACTGCCATTACAATGTTTAAXAACAATGATCCACCAGTTGGTCCCTCAGCAA
GTTCAGTGCTaTATTGAAACCAAAATTCGTAGATATTTTCGCCCAAATTCGTCAGATGTGACTTTGGTTATCGAAGAAAGAGATGGCATG
GGCATCAACGATGTCTTCACTTGTGCTGAAATCTATTTGTCTGCACGAATCAGCCCAGAATTTCAACGTTTCAAAATTACCAAACGACCC
AAAGACACAGGGGTCAATGTTAAATTTGGGAATTGTGGGAAAATTACTGATTCTTTTGAAGAGATTGAATTGGTATGGAAGTTTGTTAAT
GAAGCGAAGAAGTCGATTTCGAGATTTCAAGATGATGATGAAGGTGATTTTTCTGAGAAACATACGTTTGAGCTGAGCTTTAGCAAACAA
CACAAGGAAAGGATTCTGAATACCTACATCCTCTTTGTACTTAACACGGCCAAAACGATGCGGTACGAGAAAAAAATTATTCAATTGCAT
TCTCTTATTGGTAACTGTTATAGCTCCTATAAAATGGGAATCTGTGAACCTTGA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan