ESTScan Details for Unigene SGN-U340442

Score 
130
Direction 
Forward
Predicted Peptide Sequence 
REDPSMQGPSGSRSVVASGHSSIGTIMAGNQIAKVKPPPTQAEVQNIIPKHKAVGIQLFKPXIWAAFEVGVNLVVLCPDSGVKGCWFKFK
AIHVSQKYQKFNIMSSRIVMVLKSSRSHNNRDYNLNLYTITYDILAYINLLLYLYHIFSSPLFDLWNGLLPTELEDMKNWASDTHGTSQF
RPNRWGIISEYSLEXESCRCMLDGLRGDGKDVVVFGVWGSADLQA
Predicted Coding Sequence 
AGAGAAGATCCTTCAATGCAAGGACCTAGTGGGAGTAGAAGTGTCGTTGCGAGTGGCCATTCTAGTATCGGAACTATAATGGCTGGCAAT
CAAATTGCAAAAGTCAAACCACCACCAACTCAGGCXGAAGTCCAAAATATAATTCCCAAGCACAAGGCAGTTGGAATTCAGCTTTTTAAG
CCTXTAATTTGGGCTGCTTTTGAAGTTGGTGTCAACTTAGTGGTTCTTTGCCCTGATAGTGGCGTGAAAGGTTGTTGGTTCAAGTTTAAG
GCTATACATGTATCACAAAAATATCAAAAGTTCAATATAATGTCATCTAGGATTGTGATGGTCCTTAAAAGCTCGAGGTCCCATAACAAC
CGTGACTATAACTTAAATCTGTATACTATAACATATGATATACTTGCATATATTAACTTGTTGCTCTACCTTTACCATATTTTTTCATCA
CCTTTGTTTGATTTATGGAATGGATTACTTCCTACTGAGTTGGAGGATATGAAAAATTGGGCTTCAGATACACATGGCACATCACAGTTC
AGACCCAACCGCTGGGGGATTATTTCTGAGTATTCTTTAGAAXTAGAAAGTTGTAGATGTATGCTTGATGGGCTGAGGGGTGATGGAAAA
GATGTTGTTGTATTTGGTGTTTGGGGGAGCGCTGATCTTCAAGCTTGA
Edits in Original Sequence 
GCAGAGAAGATCCTTCAATGCAAGGACCTAGTGGGAGTAGAAGTGTCGTTGCGAGTGGCCATTCTAGTATCGGAACT(5')AGAGAAGAT
CCTTCAATGCAAGGACCTAGTGGGAGTAGAAGTGTCGTTGCGAGTGGCCATTCTAGTATCGGAACTATAATGGCTGGCAATCAAATTGCA
AAAGTCAAACCACCACCAACTCAGGCXGAAGTCCAAAATATAATTCCCAAGCACAAGGCAGTTGGAATTCAGCTTTTTAAGCCTXTAATT
TGGGCTGtCTTTTGAAGTTGGTGTCAACTTAGTGGTTCTTTGCCCTGATAGTGGCGTGAAAGGTTGTTGGTTCAAGTTTAAGGCTATACA
TGTATCACAAAAATATCtAAAAGTTCAATATAATGTCATCTAGGATTGTGATGGTCCTTAAAAGCTCGAGGTCCCATAACAACCGTGACT
ATAACTTAAATCTGTATACTATAACATATGATATACTTGCATATATTAACTTGTTcGCTCTACCTTTACCATATTTTTTCATCACCTTTG
TTTGATTTATaGGAATGGATTACTTCCTACTGAGTTGGAGGATATGAAAAATTGGGCTTCAGATACACATGGCACATCACAGTTCAGACC
CAACCGCTGGGGGATTATTTCTGAGTATTCTTTAGAAXTAGAAAGTTGTAGATGTATGCTTGATGGGCTGAGGGGTGATGGAAAAGATGT
TGTTGTATTTGGTGTTTGGGGGAGCGCTGATCTTCAAGCTTGA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan