ESTScan Details for Unigene SGN-U340450

Score 
-174
Direction 
Reverse
Predicted Peptide Sequence 
VGAFLVITPAGKGGCAARRLRWGNARVFPXPDVVKRRPVNCNTTHYRANWVPGPXLEVXXXXXXXXXDSSNITNDSATSSFKNXKKFKRK
EEILCTKLNALTGNNCKCNTYEVLKPTKVATAWGTFDKSYMGFYVMYDAPLTALKNKADESYALDLDAXFEGDVTTGMSKLVLSVSDATS
LTSAILALLVEYHSTHHFQLTDGSFDLLLDQLHSLEAHDDGPRNA
Predicted Coding Sequence 
XGGGTGGGGGCTTTTTTGGTTATTACGCCAGCTGGAAAAGGGGGATGTGCTGCAAGGCGATTAAGGTGGGGTAACGCCAGGGTTTTCCCA
GXTCCCGACGTTGTAAAACGACGGCCAGTGAATTGTAATACGACTCACTATAGGGCGAATTGGGTACCGGGCCCCXCCCTCGAGGTTTNN
NNNNNNNNNNNNNNTNTNNNNNNAGATTCTTCAAACATCACAAACGACTCAGCTACGTCATCATTTAAGAATAAXAAAAAGTTTAAAAGG
AAAGAGGAGATACTATGCACAAAGTTAAACGCACTGACAGGCAATAATTGTAAGTGTAATACTTATGAGGTCCTAAAGCCAACAAAAGTT
GCTACTGCTTGGGGCACATTTGACAAGAGTTATATGGGGTTCTATGTGATGTACGACGCGCCTTTGACAGCATTGAAAAACAAGGCTGAT
GAGAGTTATGCCCTTGATCTTGATGCACXGTTTGAAGGCGATGTAACTACTGGTATGTCTAAGCTGGTCCTTTCTGTTTCAGATGCTACC
TCTCTTACATCAGCTATTCTGGCTCTGTTGGTTGAATATCACTCCACTCACCATTTTCAATTGACTGATGGTTCGTTTGATCTACTGTTA
GATCAACTACATTCTCTGGAGGCACATGATGATGGCCCTCGAAACGCTTAA
Edits in Original Sequence 
(5')XGGGTGGGGGCTTTTTTGGTTATTACGCCAGCTGcGAAAAGGGGGATGTGCTGCAAGGCGATTAAGGTGGGGTAACGCCAGGGTTT
TCCCAGXTCCCGACGTTGTAAAACGACGGCCAGTGAATTGTAATACGACTCACTATAGGGCGAATTGGGTACCGGGCCCCXCCCTCGAGG
TTTNNNNNNNNNNNNNNNNTNTNNNNNNAGATTCTTCAAACATCACAAACGACTCAGCTACGTCATCATTTAAGAATAAXAAAAAGTTTA
AAAGGAAAGAGGAGATACTATGCACAAAGTTAAACGCACTGACAGGCAATAATTGTAAGTGTAATACTTATGAGGTCCTAAAGaCCAACA
AAAGTTGCTACTGCTTGGGGCACATTTGACAtAGAGTTATATGGGGTTCTATGTGATGTACGACGCGCCTTTGACAGCATTGAAAAACtA
AGGCTGATGAGAGTTATGCCCTTGATCTTGATGCACXGTTTGAAGGCGATGTAACTACTGGTATGTCTAAGCTGGTCCTTTCTGTTTCAG
ATGCTACCTCTCTTACATCAGCTATTCTGGaCTCTGTTGGTTGAATATCACTCCACTCACCATTTTCAATTGACTGATGGTTCGTTTGAT
CTACTGTTAGATCAACTACATTCTCTGGAGGCACATGATcGATGGCCCTCGAAACGCTTAA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan