ESTScan Details for Unigene SGN-U340500

Score 
191
Direction 
Forward
Predicted Peptide Sequence 
RPPNTGTRAAAAHNYWIPRACRIRHDAFCQQKEKKASSGIGSTQVVPSVPEGVSSNQTQNNESTVQFQGFGYFGDGSAASATSSSIRPAS
SSVPAHASDPSKLSQPPTYGPQGSSSSEFLAFSESIKSKWSSASARHKDSISTGTRGFKEKLLPRNTTVKEFGTQAQREMSAGIPGVSRM
IERLDLTSQRTGPADPSVCTTGTSNFPGTGSTAPGNVTFPHPDGCRNNTNIGVPPXLSPLDLQPPPHPPPPPLGPWNFLPDPMQTDRPPP
LRIPQHLTPAYRPPSPLLTPPPPHSMHPHSDPTLSHDPLIAPTAAPDSPPPPPLRTPATTLIPPSPTITPPPRLSPPIXALIALALFNPA
NPYHPPAIPTPRRSYKSPPEYSTHAPTYLRGPLSPYHAHHLTS
Predicted Coding Sequence 
XCACGCCCCCCAAACACAGGAACTCGGGCGGCGGCCGCTCACAACTATTGGATCCCCCGGGCCTGCAGAATTCGGCACGACGCCTTTTGT
CAACAGAAGGAGAAGAAGGCGTCTTCAGGAATTGGTTCTACACAGGTTGTACCTTCAGTGCCGGAAGGAGTTAGTTCAAACCAGACACAG
AATAATGAATCCACAGTACAGTTCCAAGGCTTTGGATATTTTGGGGATGGGTCTGCTGCTTCTGCAACTTCATCTAGTATTAGACCTGCA
TCATCATCAGTTCCTGCCCATGCAAGTGATCCTTCTAAGCTTAGCCAACCACCAACTTATGGTCCCCAGGGGTCAAGCTCATCCGAGTTT
CTTGCATTTTCTGAATCTATAAAATCCAAATGGTCTTCTGCTTCTGCGAGGCATAAGGACTCAATCTCCACAGGTACTCGTGGTTTTAAG
GAAAAATTATTACCACGCAACACCACTGTCAAGGAATTTGGCACACAAGCTCAACGTGAGATGAGTGCTGGAATACCTGGCGTTTCACGA
ATGATTGAACGACTTGATCTTACCTCCCAACGCACTGGCCCTGCTGACCCATCTGTATGTACCACGGGTACCTCCAATTTTCCCGGCACA
GGATCGACTGCACCAGGCAATGTGACCTTTCCCCACCCTGATGGTTGCCGCAACAATACTAACATCGGAGTTCCTCCTXATCTATCCCCT
CTTGATCTCCAACCCCCTCCCCATCCCCCACCCCCXCCCCTCGGCCCATGGAACTTCCTCCCGGACCCAATGCAAACTGATCGTCCCCCA
CCCCTTCGAATCCCACAACACCTGACGCCTGCCTACCGCCCCCCCTCCCCTCTACTAACTCCTCCTCCCCCACACTCCATGCACCCCCAC
AGCGATCCCACCCTCTCACACGACCCCCTCATTGCCCCCACCGCXGCACCTGACTCTCCCCCCCCTCCCCCCCTTCGCACCCCCGCGACC
ACTCTCATCCCGCCTTCTCCCACAATAACACCACCTCCGCGCCTTTCACCCCCTATACXGGCTCTCATTGCCCTCGCTCTCTTCAACCCG
GCCAACCCTTACCACCCACCCGCCATCCCAACTCCTCGCCGTTCGTATAAATCCCCTCCGGAATACTCAACCCACGCCCCCACATACCTC
CGCGGCCCTCTCTCTCCCTACCACGCGCACCACCTCACCTCGTGA
Edits in Original Sequence 
(5')XCACGCCCCCCAAACACAGGAACTCGGGCGGCGGCCGCTCACAACTATTGGATCCCCCGGGCCTGCAGAATTCGGCACGACGCCTT
TTGTCAACAGAAGGAGAAGAcAGGCGTCTTCAGGAATTGGTTCTACACAGGTTGTACCTTCAGTGCCGGAAGGAGTTAGTTCAAACCAGA
CACAGAATAATGAATCCACAGTACAGTTCCAAGGCTTTGGATATTTTGGGGATGGGTCTGCTGCTTCTGCAACTTCATCTAGTATTAGAC
CTGCATCATCATCAGTTCCTGCCCATGCAAGTGATCCTTCTAAGCTTAGCCAACCACCAACTTATGGTCCCCAGGGGTCAAGCTCATCCG
AGTTTCTTGCATTTTCTGAATCTATAAAATCCAAATGGTCTTCTGCTTCTGCGAGGCATAAGGACTCAATCTCCACAGGTACTCGTGGTT
TTAAGGAAAAATTATTACCACGCAACACCACTGTCAAGGAATTTGGCACACAAGCTCAACGTGAGATGAGTGCTGGAATACCTGGCGTTT
CACGAATGATTGAACGACTTGATCTTACCTCCCAACGCACTGGCCCTGCTGACCCATCTGTATGTACCACGGGTACCTCCAATTTTCCCG
GCACAGGATCGACTGCACCAGGCAATGTGACCTTTCCCCACCCTGATGGTTGCCGCAACAATACTAACATCGGAGTTCCTCCTXATCTAT
CCCCTCTTGATCTCCAACCCCCTCCCCATCCCCCACCCCCXCCCCTCGGCCCATGGAACTTCCTCCCGGACCCAATGCAAACTGATCGTC
CCCCACCCCTTCGAATCCCACAACACCTGACGCCTGCCTACCGCCCCCCCTCCCCTCTACTAACTCCTCCTCCCCCACACTCCATGCACC
CCCACAGCGATCCCACCCTCTCACACGACCCCCTCATTGCCCCCACCGCXGCACCTGACTCTCCCCCCCCTCCCCCCCTTCGCACCCCCG
CGACCACTCTCATCCCGCCTTCTCCCACAATAACACCACCTCCGCGCCTTTCACCCCCTATACXGGCTCTCATTGCCCTCGCTCTCTTCA
ACCCGGCCAACCCTTACCACCCACCCGCCATCCCAACTCCTCGCCGTTCGTATAAATCCCCTCCGGAATACTCAACCCACGcCCCCCACA
TACCTCCGCGGCCCTCTCTCTCCCTACCACGCGCACCACCTCACCTCGTGA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan