ESTScan Details for Unigene SGN-U340580

Score 
272
Direction 
Forward
Predicted Peptide Sequence 
GYVPEGIKAAKLVLEYTKHTMLVGDQASAFAISMGLQGPTNLSSVESKRSGQNGKIILANLISGKMLSLEIVVVHSIPFKRICRVGDGPI
AGSSAYADAEVGACGATGDGDIMMRFLPCYQAVENMRLGMEPKLAAKDAISRIARKYPNFIGALFAVNRNGTHAGACHGWTFQYCVRTPG
MNDVEVFTVHPQ
Predicted Coding Sequence 
GGATATGTGCCAGAGGGAATTAAAGCTGCGAAGTTAGTGTTGGAGTATACTAAACATACTATGCTCGTCGGGGATCAAGCCTCAGCTTTT
GCCATTTCGATGGGCCTTCAGGGGCCTACAAACCTAAGCTCAGTTGAGTCAAAGAGAAGTGGACAAAATGGAAAGATAATTCTTGCCAAC
CTAATTTCCGGAAAAATGTTATCCCTAGAGATAGTTGTGGTCCATTCCATCCCTTTTAAACGTATTTGTAGGGTTGGTGATGGACCTATA
GCAGGGTCTTCAGCATATGCGGATGCTGAAGTTGGTGCTTGTGGAGCCACTGGGGATGGTGATATTATGATGCGCTTCCTTCCGTGTTAT
CAGGCTGTGGAGAATATGAGATTGGGAATGGAACCGAAACTTGCCGCAAAAGATGCTATATCGCGAATTGCAAGGAAATATCCAAACTTC
ATTGGCGCTCTATTTGCAGTCAACAGAAATGGGACTCATGCAGGTGCATGCCATGGTTGGACTTTTCAGTACTGTGTCAGAACTCCTGGG
ATGAACGATGTTGAGGTCTTTACTGTTCACCCTCAGTGA
Edits in Original Sequence 
GGATATGTGCCAGAGGGAATTAAAGCTGCGAAGTTAGTGTTGGAGTATACTAAACATACTATGCTCGTCGGGGATCAAG(5')GGATATG
TGCCAGAGGGAATTAAAGCTGCGAAGTTAGTGTTGGAGTATACTAAACATACTATGCTCGTCGGGGATCAAGCCTCAGCTTTTGCCATTT
CGATGGGCCTTCAGGGGCCTACAAACCTAAGCTCAGTTGAGTCAAtAGAGAAGTGGACAAAATGGAAAGATAATTCTTGCCAACCTAATT
TCCGGAAAAATGTTATCCCTAGAGATAGTTGTGGTCCATTCCATCCCTTTTAAACGTATTTGTAGGGTTGGTGATGGACCTATAGCAGGG
TCTTCAGCATATGCGGATGCTGAAGTTGGTGCTTGTGGAGCCACTGGGGATGGTGATATTATGATGCGCTTCCTTCCGTGTTATCAGGCT
GTGGAGAATATGAGATTGGGAATGGAACCGAAACTTGCCGCAAAAGATGCTATATCGCGAATTGCAAGGAAATATCCAAACTTCATTGGC
GCTCTATTTGCAGTCAACAGAAATGGGACTCATGCAGGTGCATGCCATGGTTGGACTTTTCAGTACTGTGTCAGAACTCCTGGGATGAAC
GATGTTGAGGTCTTTACTGTTCACCCTCAGTGA(3')TGCTAGAATTGATGATATCCTTC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan