ESTScan Details for Unigene SGN-U340584

Score 
56
Direction 
Reverse
Predicted Peptide Sequence 
AITPAAERGMCCKAIKLGNARVFPVTTVVKRRPVNCNTTHYRANWVPGPXLETSCLSPGIFLTSSATSXVGKKVISESGTRGIIREYRED
ELGEKEEEIEVEFEAGFYRNLRWVKSSAKGKLVGVICEADNWWLKAGIVDEGECRGGVSSEGVEEKFDGENGWEDCKIDEKNNSDNGGIV
LGFDEEEEDKFVKENYTVFLKGTRDELLVPENDEDD
Predicted Coding Sequence 
XXCGCTATTACGCCAGCTGCCGAAAGGGGGATGTGCTGCAAGGCGATTAAGTTGGGTAACGCCAGGGTTTTCCCAGTCACGACXGTTGTA
AAACGACGGCCAGTGAATTGTAATACGACTCACTATAGGGCGAATTGGGTACCGGGCCCCXCCCTCGAGACTAGTTGTCTCTCTCCGGGT
ATTTTTTTAACGTCGTCGGCTACAAGTGXTGTTGGGAAAAAAGTGATTTCAGAATCCGGGACTAGAGGAATCATCAGGGAGTACAGAGAA
GATGAACTGGGAGAGAAAGAGGAAGAAATTGAAGTGGAATTTGAAGCXGGATTTTATAGGAATTTGAGATGGGTAAAAAGCTCGGCCAAG
GGAAAATTGGTTGGAGTCATTTGTGAGGCGGATAACTGGTGGCTCAAGGCGGGCATCGTCGATGAGGGTGAGTGCAGGGGTGGTGTTAGC
AGTGAAGGAGTTGAAGAGAAATTCGATGGCGAAAATGGATGGGAAGATTGTAAAATTGATGAGAAGAACAACAGTGATAATGGTGGCATA
GTTTTGGGTTTTGACGAAGAAGAAGAAGATAAATTTGTGAAGGAAAATTACACGGTATTTTTGAAGGGAACTAGAGATGAGTTGCTGGTT
CCTGAAAATGATGAAGATGACTAA
Edits in Original Sequence 
(5')XXCGCTATTACGCCAGCTGCCGAAAGGGGGATGTGCTGCAAGGCGATTAAGTTGGGTAACGCCAGGGTTTTCCCAGTCACGACXGT
TGTAAAACGACGGCCAGTGAATTGTAATACGACTCACTATAGGGCGAATTGGGTACCGGGCCCCXCCCTCGAGACTAGTTGTCTCTCTCC
GGGTATTTTTTTAACGTCGTCGGCTACAAGTGXTGTTGGGAAAAAAGTGATTTCAGAATCCGGGACTAGAGGAATCATCAGGGAGTACAG
AGAAGATGAACTGGGtAGAGAAAGAGGAAGAAATTGAAGTGGAATTTGAAGCXGGATTTTATAGGAATTTGAGATGGGTAAAAAGCTCGG
CCAAGGGAAAATTGGTTGGAGTCATTTGTGAGGCGGATAACTGGTGGCTCAAGGCGGGCATCGTCGATGAGGGTGAGTGCAGGGGTGGTG
TTAGCAGTGAAGGAGTTGAAGAGAAATTCGATGGCGAAAATGGATGGGAAGATTGTAAAATTGATGAGAAtGAACAACAGTGATAATGGT
GGCATAGTTTTGGGTTTTGtACGAAGAAGAAGAAGATAAATTTGTGAAGGAAAATTACACGGTATTTTTGAAGGGAACTAGAGATGAGTT
GCTGGTTCtCTGAAAATGATGAAGATGACTAA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan