ESTScan Details for Unigene SGN-U340627

Score 
143
Direction 
Reverse
Predicted Peptide Sequence 
PLPAFLIPAVFKHCELQSFQYHLASIQAXIVRSSIDVVIRVHPFPIYAQTCTAESHHHVTYQATXXXAFPNKXKLINIPVLIPXNHALSX
XHFFRISSNTFSANPFPHISHINSXXKSXQRXSIQTQIEQHAYALVALIKRRQNRTRLQHKRQSETIRFRVVSLDQFLEYEKGFVRSGMG
FKKTSNERIIENILGFGDLGKDPFGVIEAAMGERAAKVRTFERMKEIAEDGRXRMSDDMAMDXVEGFSDLDIFEPVKRVFLLLLPALRTL
SDPRAEFLQPGGSTSSRAAATAVSSX
Predicted Coding Sequence 
XXCCCTTTGCCAGCATTTCTTATTCCAGCTGTTTTTAAGCATTGTGAACTTCAATCCTTTCAGTACCACCTTGCATCTATACAGGCAGXT
ATAGTCAGATCATCCATCGATGTTGTGATTAGAGTGCACCCCTTCCCAATTTACGCCCAGACATGCACCGCNGAATCACATCACCATGTC
ACTTATCAGGCAACACNNNTTNTTGCATTCCCTAACAAANTAAAGCTCATTAACATCCCAGTCTTGATACCCCANAATCATGCACTCAGC
ANNNCCCATTTCTTCAGAATTTCATCAAACACTTTCTCCGCCAACCCATTTCCTCACATTTCGCATATAAATTCANCANCGAAGTCTGAN
CAAAGGNACTCGATCCAAACCCAGATTGAACAACATGCTTATGCACTTGTTGCCCTCATCAAACGCCGCCAAAATAGAACACGACTTCAA
CACAAACGCCAAAGTGAAACTATTCGTTTTCGGGTAGTTTCTCTTGACCAATTTCTTGAATATGAAAAGGGGTTCGTTAGAAGCGGTATG
GGATTCAAGAAAACCTCTAATGAGAGAATTATTGAAAATATACTAGGATTTGGXGATTTGGGTAAGGACCCGTTTGGCGTAATTGAGGCT
GCCATGGGTGAAAGAGCTGCAAAAGTGAGAACTTTTGAGAGAATGAAGGAGATTGCTGAAGATGGAAGAAAXCGAATGAGTGATGATATG
GCCATGGATXTTGTTGAAGGATTCTCAGATTTGGACATTTTTGAACCAGTGAAACGAGTCTTTCTTCTACTTCTTCCAGCTCTTCGAACT
TTGAGTGACCCTCGTGCCGAATTCCTGCAGCCCGGGGGATCCACTAGTTCTAGAGCGGCCGCCACCGCGGTGAGCTCCAXX
Edits in Original Sequence 
(5')XXCCCTTTGCCAGCATTTCTTATTCCAGCTGTTTTTAAGCATTGTGAACTTCAATCCTTTCAGTACCACCTTGCATCTATACAGGC
AGXTATAGTCAGATCATCCATCGATGTTGTGATTAGAGTGCACCCCTTCCCAATTTACGCCCAGACATGCACCGCNGAATCACATCACCA
TGTCACTTATCAGGCAACACNNNTTNtTTGCATTCCCTAACAAANTAAAGaCTCATTAACATCCCAGTCTTGATACCCCANAATCATGCA
CTCAGCANNNCCCATTTCTTCAGAATTTCATCAAACACTTTCTCCGCCAACCCATTTCCTCACATTTCGCATATAAATTCANCANCGAAG
TCTGANCAAAGGNACTCGATCCAAACCCAGATTGAACAACATGCTTATGCACTTGTTGcCCCTCATCAAACGCCGCCAAAATAGAACACG
ACTTCAACACAAACGCCAAAGTGAAACTATTCGTTTTCGGGTAGTTTCTCTTGACCAATTTCTTGAATATGAAAAGGGGTTCGTTAGAAG
CGGTATGGGATTCAAGAAAACCTCTAATGAGAGAATTATaTGAAAATATACTAGGATTTGGXGATTTGGGTAAGGACCCGTTTGGCGTAA
TTGAGGCTGCCAtTGGGTGAAAGAGCTGCAAAAGTGAGAACTTTTGAGAGAATGAAGGAGATTGCTGAAGATGGAAGAAAXCGAATGAGT
GATGATATGGCCATGGATXTTGTTGAAGGATTCTCAGATTTGGACATTTTTGAACCAGTGAAACGAGTCTTTCTTCTACTTCTTCCAGCT
CTTCGAACTTTGAGTGACCCTCGTGCCGAATTCCTGCAGCCCGGGGGATCCACTAGTTCTAGAGCGGCCGCCACCGCGGTGAGCTCCAXX
(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan