ESTScan Details for Unigene SGN-U340628

Score 
290
Direction 
Forward
Predicted Peptide Sequence 
WTPIFETLLELHRGGGRSRTSGSPGLQVKLIYSGGMALDILPQGAGKGQALVYLLKKLKSEGKLPNNTLVCGDSGNDAELFSIPDVYGVM
VSNAQEELLQWHAANAKDNPKVIHATERCAAGIIQAIGRFNLGPSTSPRDVTDMSDSKMENFVPAYEFVKFYLFFEKWRRGEIENSDLYL
SNLKAVCRPSGTFVHPSGVEKSFEEXRKYIEKXVMATKKVNNIEIWVEQVLTTRVX
Predicted Coding Sequence 
XTCTGGACCCCAATCTTTGAAACTTTGCTGGAGCTCCACCGCGGTGGCGGCCGCTCTAGAACTAGTGGATCCCCCGGGCTGCAGGTCAAA
TTAATTTACAGTGGAGGGATGGCTTTAGATATTTTGCCGCAAGGTGCTGGCAAAGGACAAGCACTCGTGTATTTGCTGAAGAAATTAAAG
AGTGAGGGGAAATTACCAAACAACACGCTTGTCTGTGGTGACTCTGGAAATGATGCTGAGCTTTTCAGCATCCCGGATGTTTACGGTGTG
ATGGTATCGAATGCACAGGAGGAATTATTACAATGGCATGCTGCAAATGCGAAAGATAATCCGAAAGTAATTCATGCAACAGAGAGATGT
GCTGCGGGTATAATACAAGCCATTGGGCGTTTCAACCTGGGACCAAGTACCTCTCCTAGAGACGTTACCGATATGTCAGACAGTAAGATG
GAGAATTTTGTTCCTGCTTATGAATTCGTCAAATTTTACCTGTTTTTCGAGAAATGGAGGCGTGGAGAGATAGAGAATTCTGACCTTTAC
TTGTCGAACCTGAAAGCAGTTTGTAGACCATCTGGTACTTTTGTGCACCCGTCTGGAGTTGAGAAATCTTTTGAAGAAXTGCGTAAATAC
ATTGAAAAAGXTGTCATGGCGACAAAAAAGGTAAACAATATCGAAATTTGGGTGGAACAAGTCTTAACTACACGGGTTGXX
Edits in Original Sequence 
(5')XTCTGGACCCCAATCTTTGAAACTTTGCTGGAGCTCCACCGCGGTGGCGGCCGCTCTAGAACTAGTGGATCCCCCGGGCTGCAGGT
CAAATTAATTTACAGTGGAGGGATGGCTTTAGATATTTTGCCGCAAGGTGCTGGCAAAGGACAAGCACTCGTGTATTTGCTGAAGAAATT
AAAGAGTGAGGGGAAATTACCAAACAACACGCTTGTCTGTGGTGACTCTGGAAATGATGCTGAGCTTTTCAGCATCCCGGATGTTTACGG
TGTGATGGTATCGAATGCACAGGAGGAATTATTACAATGGCATGCTGCAAATGCGAAAGATAATCCGAAAGTAATTCATGCAACAGAGAG
ATGTGCTGCGGGTATAATACAAGCCATTGGGCGTTTCAACCTGGGACCAAGTACCTCTCCTAGAGACGTTACCGATATGTCAGACAGTAA
GATGGAGAATTTTGTTCCTGCTTATGAATTCGTCAAATTTTACCTGTTTTTCGAGAAATGGAGGCGTGGAGAGATAGAGAATTCTGACCT
TTACTTGTCGAACCTGAAAGCAGTTTGTAGACCATCTGGTACTTTTGTGCACCCGTCTGGAGTTGAGAAATCTTTTGAAGAAXTGCGTAA
ATACATTGAAAAAGXTGTCATGGCGACAAAAAAGGTAAACAATATCGAAATTTGGGTGGAACAAGTCTTAACTACACGGGTTGXX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan