ESTScan Details for Unigene SGN-U340657

Score 
-534
Direction 
Forward
Predicted Peptide Sequence 
EGRRXLVGDKEKVGVHAVAAALELVDPRAAGIPPRKECRHWPSKYLVLSEDVDIGPGKLRSWVSIASVVTKKRITADAHFFMYPYRVCER
LIQDFYCTEFNPLNFLARNSLSFYKKKKKKTRGGARSPIRPIVSRITIHWPSFYTVVTGKTLAFPTLIALQHIPPFASWRNSEEAPPDRP
SQQLRRLNGEWQIVSLNILLKFALIFVKSAHFLTHRPKSAKSLINQKNSPEIGLSVVPXLEPESPIKERGPPRPKAKKPSIRAIXPTTGT
LPPNQVFLGVEGPEKAQNPEPLKGNPXHFKTLTRGKAPPNPGKKKGREKKPKGTRPPRAPLQKFPAP
Predicted Coding Sequence 
XNNNGGGAGGGGAGGCGGGNTTTGGTGGGAGATAAGGAGAAGGTAGGGGTCCACGCGGTGGCGGCCGCTCTAGAACTAGTGGATCCCCGG
GCTGCAGGAATTCCGCCGAGGAAAGAATGTAGACATTGGCCATCAAAGTATCTTGTACTTTCTGAAGATGTTGATATTGGACCAGGTAAA
CTTAGGTCTTGGGTGAGTATTGCCTCTGTAGTTACAAAGAAAAGAATAACCGCCGACGCCCATTTCTTTATGTACCCGTATCGTGTGTGT
GAGAGGCTGATTCAAGATTTTTATTGTACCGAGTTCAACCCTTTAAATTTCTTAGCACGGAATTCATTGTCCTTTTATAAAAAAAAAAAA
AAAAAAACTCGAGGGGGGGCCCGGTCCCCAATTCGCCCTATAGTGAGTCGTATTACAATTCACTGGCCGTCGTTTTACACCGTCGTGACT
GGGAAAACCCTGGCGTTCCCCACCTTAATCGCCTTGCAGCACATCCCCCCTTTCGCCAGCTGGCGTAATAGCGAAGAGGCCCCCCCCGAT
CGCCCTTCCCAACAGTTGCGCCGCCTGAATGGCGAATGGCAAATTGTAAGCCTTAATATTTTGTTAAAATTCGCGTTAATTTTTGTTAAA
TCAGCTCATTTTTTAACCCATAGGCCCAAATCGGCAAAATCCCTTATAAATCAAAAGAATAGCCCXGAGATAGGGTTGAGTGTTGTTCCA
GXTTTGGAACCAGAGTCCCCTATTAAAGAACGTGGACCTCCACGTCCAAAGGCGAAAAAACCGTCTATCCGGGCGATTGXCCCCACTACT
GGAACCCTCCCCCCTAATCAAGTTTTTTTGGGGGTCGAGGGGCCCGAAAAAGCCCAAAATCCGGAACCCCTTAAGGGAAACCCCCXCCAT
TTTAAAACCTTGACCCGGGGAAAAGCCCCGCCCAACCCTGGCAAAAAAAAGGGAAGGGAAAAAAAACCCAAAGGGACCCGGCCCCCCAGG
GCCCCCTTGCAAAAATTTCCGGCCCCC
Edits in Original Sequence 
(5')XNNNGGGAGGGGAGGCGGGNTTTGGTGGGAGATAAGGAGAAGGTAGGGGTCCACGCGGTGGCGGCCGCTCTAGAACTAGTGGATcC
CCCGGGCTGCAGGAATTCCGcCCGAGGAAAGAATGTAGACATTGGCCATCAAAGTATCTTGTACTTTCTGAAGATGTTGATATTGGACCA
GGTAAACTTAGGTCTTGGGTGAGTATTGCCTCTGTAGTTACAAAGAAAAGAATAACCGCCGACGCCCATTTCTTTATGTACCCGTATCGT
GTGTGTGAGAGGCTGATTCAAGATTTTTATTGTACCGAGTTCAACCCTTTAAATTTCTTAGCACGGAATTCATTGTCCTTTTATAAAAAA
AAAAAAAAAAAAACTCGAGGGGGGGCCCGGTCCCCAATTCGCCCTATAGTGAGTCGTATTACAATTCACTGGCCGTCGTTTTACACCGTC
GTGACTGGGAAAACCCTGGCGTTCCCCACCTTAATCGCCTTGCAGCACATCCCCCCTTTCGCCAGCTGGCGTAATAGCGAAGAGGCCCCC
CCCGATCGCCCTTCCCAACAGTTGCGCCGCCTGAATGGCGAATGGCAAATTGTAAGCCTTAATATTTTGTTAAAATTCGCGTTaAATTTT
TGTTAAATCAGCTCATTTTTTAACCCATAGGCCCAAATCGGCAAAATCCCTTATAAATCAAAAGAATAGCCCXGAGATAGGGTTGAGTGT
TGTTCCAGXTTTGGAACCAGAGTCCCCTATTAAAGAACGTGGACCTCCACGTCCAAAGGCGAAAAAACCGTCTATCCGGGCGATTGXCCC
CACTACTGGAACCCTCCCCCCTAATCAAGTTTTTTTGGGGGTCGAGGGGCCCGAAAAAGCCCtAAAATCCGGAACCCCTTAAGGGAAACC
CCCXCCATTTTAAAACCTTGACCCGGGGAAAAGCCCCGCCCAACCCTGGCAAAAAAAAGGGAAGGGAAAAAAAACCCAAAGGGACCCGGC
CCCCCAGGGCCCCCTTGCAAAAATTTCCGGCCCCC(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan