ESTScan Details for Unigene SGN-U340770

Score 
388
Direction 
Forward
Predicted Peptide Sequence 
MAFLKTGIQIIVTRACGLVSIDVRESANAGPSWIFVERKTPPELGNLTHLKSLVLSENRLFGAIPKEFGRLRMLEVLDMRDNNLSGRIPA
VIGDLQSLRTLLICDNNFEGKIPLEIGRLRLLSDLQFDDYLNSGIVAGTGCINRKFGYCIXAWQFEAMLDYKSFVKPIKRMLAWDFSFFT
LVPRFLDAQEEFLVLQPYQVPVGPTIFTPERIKANGGTPESFLDQSRTLVGSSGNXEKNPWDPV
Predicted Coding Sequence 
ATGGCATTCTTGAAAACTGGAATTCAGATCATTGTGACCCGTGCTTGTGGTCTGGTGTCCATTGATGTACGGGAGAGTGCAAATGCTGGA
CCTTCATGGATATTCGTTGAAAGGAAAACTCCACCAGAACTTGGAAATCTCACTCACTTAAAATCACTTGTGCTTTCTGAAAACCGTCTT
TTTGGTGCTATTCCTAAAGAATTTGGACGACTGAGAATGCTGGAAGTGCTTGACATGAGAGATAACAATTTGAGTGGAAGAATTCCAGCA
GTAATAGGAGATTTGCAATCACTTAGAACCTTGTTGATTTGTGACAATAACTTCGAAGGGAAAATCCCTTTAGAGATCGGGAGGCTTCGC
CTTCTCTCAGACTTGCAATTTGATGATTACCTCAACTCTGGTATTGTTGCCGGAACTGGCTGCATAAATAGGAAATTTGGGTATTGCATC
XTGGCATGGCAGTTTGAGGCCATGTTAGACTATAAGTCCTTTGTCAAGCCAATTAAAAGGATGCTAGCATGGGATTTTAGTTTTTTCACA
CTGGTCCCGCGTTTTTTGGATGCTCAGGAAGAATTCTTGGTTTTACAACCCTACCAGGTTCCGGTTGGGCCTACCATATTCACCCCGGAG
AGAATCAAAGCCAATGGTGGAACCCCCGAAAGTTTTCTTGACCAATCCAGAACTCTAGTTGGTTCCTCTGGTAACXCGGAGAAAAACCCT
TGGGACCCGGTT
Edits in Original Sequence 
TCAAATTGTCGTATCTCACTCTTTTGATTATCATTTTGAATATTCGCGGTTGTTGTTCTCTTAATTCGGAAGGATTGGCATTATTGAGAT
TCCGTGTGAAAGTTGATTCTGATCCATATGGCATTCTTGAAAACTGGAATTCAGATCATTGTGACCCGTGCTTGTGGTCTGGTGTCCATT
GTATGTACGGGAGAGTGCAA
(5')ATGGCATTCTTGAAAACTGGAATTCAGATCATTGTGACCCGTGCTTGTGGTCTGGTGTCCATTGtA
TGTACGGGAGAGTGCAAATGCTGGACCTTCATGGATATTCGTTGAAAGGAAAACTCgCACCAGAACTTGGAAATCTCACTCACTTAAAAT
CACTTGTGCTTTCTGAAAACCGTCTTTTTGGTGCTATTCCTAAAGAATTTGGACGACTGAGAATGCTGGAAGTGCTTGACATGAGAGATA
ACAATTTGAGTGGAAGAATTCCAGCAGTAATAGGAGATTTGCAATCACTTAGAACCTTGTTGATTTGTGACAATAACTTCGAAGGGAAAA
TCCCTTTAGAGATCGGGAGGCTTCGCCTTCTCTCAGACTTGCAATTTGATGATTACCTCAACTCTGGTATTGTTGCCGGAACTGGCTGCA
TAAATAGGAAATTTGGGTATTGCATCXTGGCATGGCAGTTTGAGGCCATGTTAGACTATAAGcTCCTTTGTCAAGCCAATTAAAAGGATG
CTAGCATGGGATTTTAGTTTTTTCACACTGGTCCCGCGTTTTTTGGATGCTCAGGAAGAATTCTTGGTTTTACAACCCTACCAGGTTCCG
GTTGGGCCTACCATATTCACCCCGGAGAGAATCAAAGCCAATGGTGGAACCCCCGAAAGTTTTCTTGACCAATCCAGAACTCTAGTTGGT
TCtCTCTGGTAACXCGGAGAAAAACCCTTGGGACCCGGTT(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan