ESTScan Details for Unigene SGN-U340772

Score 
670
Direction 
Forward
Predicted Peptide Sequence 
WDPPWRRSRTSGSPGLQEFGTRQISVLRIEEDNNELEEKVKRVQQGMQQVMGKSGSLVFCAGEVQVYTLEQLMRASAELLGRGTMGTTYK
AVLDNRLIVCVKRLDGGRLAGTSQEEFEQHMESVGGLRHPNLVPFRAYFQARQERLLVYDYQPNGSLFSLIHGSKSSRAKPLHWTSCLKI
AEDVAQGLSYIHQAWRLVHGNLKSSNVLLGSDFEACITDYCLSVLAVPSDDENPDSVAYQAPEIRKLNHNNHHHHRQASAKADVYSFGVL
LLELLTGKPSSEHPYLMPDDMIHWVKSTKEDYDGSGCQHNKLGEAFLNLLWLVKLTSPKPKPTMWQGFKMIPKIKKPVVMEKNYENGLFP
W
Predicted Coding Sequence 
XCATGGGATCCGCCGTGGCGGCGCTCTAGAACTAGTGGATCCCCCGGGCTGCAGGAATTCGGCACGAGGCAGATTTCAGTATTGAGGATT
GAAGAAGATAACAATGAACTGGAAGAGAAGGTGAAAAGAGTACAACAAGGAATGCAGCAAGTGATGGGTAAAAGTGGGAGCTTAGTATTC
TGTGCAGGTGAGGTGCAGGTGTATACCCTGGAACAGCTGATGAGAGCTTCTGCTGAGCTTTTAGGTAGAGGAACTATGGGGACTACTTAC
AAAGCAGTGCTTGATAACCGTCTGATTGTTTGTGTGAAAAGATTAGACGGTGGGAGATTGGCCGGTACAAGTCAAGAAGAGTTTGAGCAG
CATATGGAATCAGTAGGCGGGCTTAGGCACCCGAATTTGGTTCCTTTTCGGGCTTATTTTCAGGCCCGACAAGAAAGGCTTTTGGTCTAT
GATTATCAACCCAATGGCAGCCTGTTTTCTCTTATTCATGGTTCCAAGTCATCAAGAGCAAAGCCACTTCACTGGACTTCATGTTTGAAA
ATAGCAGAGGATGTAGCTCAAGGACTTTCCTACATCCACCAAGCATGGAGGCTTGTCCATGGCAATCTCAAGTCCTCTAACGTCCTCCTC
GGCTCCGATTTCGAGGCGTGCATAACCGACTACTGTCTCTCCGTCCTAGCTGTCCCCTCGGACGATGAGAATCCTGATTCTGTAGCCTAT
CAGGCTCCAGAAATTCGTAAGCTGAATCACAACAACCACCACCACCACCGCCAAGCTAGTGCCAAGGCTGATGTCTATTCGTTTGGGGTT
CTTTTGCTTGAACTTCTAACGGGGAAACCATCTTCGGAACATCCATATCTAATGCCAGATGATATGATACACTGGGTGAAGTCTACTAAA
GAAGATTATGATGGTAGTGGTTGCCAACATAATAAACTGGGAGAAGCTTTTTTAAACTTGCTATGGCTTGTAAAACTAACCTCCCCAAAG
CCAAAACCCACAATGTGGCAAGGGTTTAAAATGATCCCGAAAATTAAGAAACCTGTTGTAATGGAAAAAAATTATGAAAATGGACTTTTT
CCTTGG
Edits in Original Sequence 
(5')XCATGGGATCCGCCGTGGCGGCGCTCTAGAACTAGTGGATCCCCCGGGCTGCAGGAATTCGGCACGAGGCAGATTTCAGTATTGAG
GATTGAAGAAGATAACAATGAACTGGAAGAGAAGGTGAAAAGAGTACAACAAGGAATGCAGCAAGTGATGGGTAAAAGTGGGAGCTTAGT
ATTCTGTGCAGGTGAGGTGCAGGTGTATACCCTGGAACAGCTGATGAGAGCTTCTGCTGAGCTTTTAGGTAGAGGAACTATGGGGACTAC
TTACAAAGCAGTGCTTGATAACCGTCTGATTGTTTGTGTGAAAAGATTAGACGGTGGGAGATTGGCCGGTACAAGTCAAGAAGAGTTTGA
GCAGCATATGGAATCAGTAGGCGGGCTTAGGCACCCGAATTTGGTTCCTTTTCGGGCTTATTTTCAGGCCCGACAAGAAAGGCTTTTGGT
CTATGATTATCAACCCAATGGCAGCCTGTTTTCTCTTATTCATGGTTCCAAGTCATCAAGAGCAAAGCCACTTCACTGGACTTCATGTTT
GAAAATAGCAGAGGATGTAGCTCAAGGACTTTCCTACATCCACCAAGCATGGAGGCTTGTCCATGGCAATCTCAAGTCCTCTAACGTCCT
CCTCGGCTCCGATTTCGAGGCGTGCATAACCGACTACTGTCTCTCCGTCCTAGCTGTCCCCTCGGACGATGAGAATCCTGATTCTGTAGC
CTATCAGGCTCCAGAAATTCGTAAGCTGAATCACAACAACCACCACCACCACCGCCAAGCTAGTGCCAAGGCTGATGTCTATTCGTTTGG
GGTTCTTTTGCTTGAACTTCTAACGGGGAAACCATcCTTCGGAACATCCATATCTAATGCCAGATGATATGATACACTGGGTGAAGTCTA
CTAAAGAAGATTATGATGGTAGTGGTTGCCAACATAATAAACTGGGAGAAGCTTTTTTAAACTTGCTATGGCTTGTAAAACTAACCTCCC
CAAAGCCAAAACCCACAATGTGGCAAGGGTTTAAAATGATCCCGAAAATTAAGAAACCTGTTGTAATGGAAAAAAATTATGAAAATGGAC
TTTTTCCTTGG(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan