Notice: The SGN server will be upgraded later today. SGN may be intermittently unavailable during the upgrade. We apologize for any inconvenience.

ESTScan Details for Unigene SGN-U340775

Score 
162
Direction 
Forward
Predicted Peptide Sequence 
MVSADFPLFIPARDACYMQSEITPLPPSPPPFSFDTKIKINPPTAIILVTLISVFFAMGIVSVYVRQCADRRFIGDFELADEDSGHAALD
RXGLDPVVITSFPMFFYSDVKHHKIGKSVLECAICLNEFEDAEALRLLPKCSHVFHPNCIDAWLFSHITCPVCRANLLPDPSDFDKIATP
VYYSNSGSPDLEFRNSVTIDINNIASPGMINVAQTPVHNRSPKTNFEITGKIPKVSFHRSLTGSDPLKMASGFTLRYPGEVPEKMIYLGP
GRAPTX
Predicted Coding Sequence 
ATGGTTTCTGCTGATTTCCCTTTGTTTATTCCTGCTCGCGATGCATGTTATATGCAATCAGAAATAACACCATTACCACCATCACCACCA
CCATTTTCATTTGATACGAAAATAAAAATCAACCCACCTACGGCTATCATTTTAGTTACACTTATCAGTGTTTTCTTCGCTATGGGAATT
GTTTCAGTCTACGTCCGTCAATGCGCCGACCGCCGCTTCATCGGCGACTTCGAATTAGCAGACGAAGATTCTGGACACGCGGCGCTCGAT
CGCXATGGACTAGACCCAGTCGTAATTACCTCTTTCCCTATGTTTTTTTACTCTGATGTTAAACATCACAAAATTGGGAAATCAGTGTTA
GAATGTGCAATTTGTTTAAACGAATTCGAAGATGCTGAAGCTCTTCGACTTCTTCCTAAATGCTCTCATGTTTTTCATCCAAATTGCATC
GACGCTTGGTTATTTTCTCATATTACCTGCCCTGTTTGTCGTGCCAATTTACTCCCGGACCCCAGCGATTTCGATAAAATCGCCACTCCG
GTTTATTACTCGAATTCCGGTTCACCTGACCTGGAATTCCGTAACTCGGTAACTATAGATATCAACAATATTGCTTCACCTGGAATGATA
AATGTAGCACAAACACCTGTTCATAATCGTTCCCCCAAGACGAATTTCGAAATTACTGGGAAAATTCCAAAGGTCTCATTCCACCGGTCA
CTCACCGGTTCGGACCCATTGAAAATGGCGAGCGGGTTTACGTTAAGGTACCCCGGAGAGGTTCCAGAGAAAATGATTTATTTGGGTCCA
GGTCGAGCCCCAACCCXX
Edits in Original Sequence 
GTACTTGTCCATCATTTATTTGATTGTTTTTTTTTTCTAATGAAGATGATAATCGAGCTAAGCCATGGTTTCTGCTCGATTTCCCTTTGT
TTATTCCTGCTCGCGATGCATGTTATATCGCAATCAGAAATAACACCATTACCACCATCACCACCACCATTTTCATTTGATACGAAAATA
(5')ATGGTTTCTGCTcGATTTCCCTTTGTTTATTCCTGCTCGCGATGCATGTTATATcGCAATCAGAAATAACACCATTACCACCATCA
CCACCACCATTTTCATTTGATACGAAAATAAAAATCAACCCACCTACGGCTATCATTTTAGTTACACTTATCAGTGTTTTCTTCGCTATG
GGAATTGTTTCAGTCTACGTCCGTCAATGCGCCGACCGCCGCTTCATCGGCGACTTCGAATTAGCAGACGAAGATTCTGGACgACGCGGC
GCTCGATCGCXATGGACTAGACCCAGTCGTAATTACCTCTTTCCCTATGTTTTTTTACTCTGATGTTAAACATCACAAAATTGGGAAATC
AGTGTTAGAATGTGCAATTTGTTTAAACGAATTCGAAGATGCTGAAGCTCTTCGACTTCTTCCTAAATGCTCTCATGTTTTTCATCCAAA
TTGCATCGACGCTTGGTTATTTTCTCATATTACCTGCCCTGTTTGTCGTGCCAATTTACTCCCGGACCCCAGCGATTTCGATAAAATCGC
CACTCCGGTTTATTACTCGAATTCCGGTTCACCTGACCTGGAATTCCGTAACTCGGTAACTATAGATATCAACAATATTGCTTCACCTGG
AATGATAAATGTAGCACAAACACCTGTTCATAATCGTTCCCCCAAGACGAATTTCGAAATTACTGGGAAAATTCCAAAGGTCTCATTCCA
CCGGTCACTCACCGGTTCGGACCCATTGAAAATGGCGAGCGGGTTTACGTTAAGGTACCCCGGAGAGGTTCCAGAGAAAATGATTTATTT
aGGGTCCAGGTCGAGCCCCAACCCXX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan